Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9P790

Protein Details
Accession Q9P790   
Localization Confidence High
Confidence Score 20.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-107LRDEERIKKRKIQKNRAANLQRTHydrophilic
119-141ASEVPKKKYKKIKVDPSARRTSSHydrophilic
204-224LEEQRRLRLKRNAAKHRQLREBasic
NLS Segment(s)
PositionSequence
90-134RIKKRKIQKNRAANLQRTLQPPKRPTPSAASEVPKKKYKKIKVDP
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008895  Vps72/YL1  
IPR013272  Vps72/YL1_C  
IPR046757  YL1_N  
Gene Ontology GO:0072686  C:mitotic spindle  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0000812  C:Swr1 complex  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
GO:0006338  P:chromatin remodeling  
GO:0006355  P:regulation of DNA-templated transcription  
GO:0045815  P:transcription initiation-coupled chromatin remodeling  
KEGG spo:SPBP35G2.13c  -  
Pfam View protein in Pfam  
PF05764  YL1  
PF08265  YL1_C  
Amino Acid Sequences MSATESLVAGRTRRANAGNKMRELLEKEHLRMTQQNAEIEKEDEEYNIEEEEEAERDIEISSESSDEEAELKKLEEEGEEVEKILRDEERIKKRKIQKNRAANLQRTLQPPKRPTPSAASEVPKKKYKKIKVDPSARRTSSRMHTVLMAQSTETRLQEAKPRRKYTVSASANRQKGTMTQQQRFEEAAKTEAQNLSSLRNYVHLEEQRRLRLKRNAAKHRQLREPILKFISKTISTEDGREASNYYVAPLEHPLCHSAPPLQMPQHRAVECVITGKPAIYLDPVTQLPISNVQAFQQVREVYNQRYSWSAMLNLFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.5
4 0.6
5 0.62
6 0.6
7 0.59
8 0.56
9 0.54
10 0.5
11 0.45
12 0.44
13 0.42
14 0.41
15 0.44
16 0.43
17 0.42
18 0.42
19 0.43
20 0.41
21 0.4
22 0.43
23 0.39
24 0.41
25 0.39
26 0.35
27 0.3
28 0.25
29 0.21
30 0.16
31 0.16
32 0.15
33 0.14
34 0.13
35 0.12
36 0.09
37 0.1
38 0.11
39 0.1
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.09
63 0.09
64 0.11
65 0.14
66 0.13
67 0.13
68 0.13
69 0.13
70 0.13
71 0.13
72 0.11
73 0.1
74 0.18
75 0.27
76 0.37
77 0.44
78 0.48
79 0.55
80 0.65
81 0.72
82 0.76
83 0.78
84 0.77
85 0.8
86 0.83
87 0.85
88 0.82
89 0.77
90 0.7
91 0.64
92 0.59
93 0.53
94 0.55
95 0.51
96 0.51
97 0.52
98 0.55
99 0.57
100 0.54
101 0.52
102 0.5
103 0.49
104 0.46
105 0.45
106 0.42
107 0.44
108 0.48
109 0.5
110 0.51
111 0.48
112 0.52
113 0.57
114 0.62
115 0.65
116 0.69
117 0.75
118 0.77
119 0.85
120 0.87
121 0.84
122 0.83
123 0.74
124 0.66
125 0.57
126 0.52
127 0.47
128 0.44
129 0.38
130 0.3
131 0.29
132 0.28
133 0.28
134 0.23
135 0.18
136 0.11
137 0.1
138 0.11
139 0.12
140 0.1
141 0.1
142 0.09
143 0.1
144 0.18
145 0.27
146 0.36
147 0.43
148 0.47
149 0.48
150 0.5
151 0.52
152 0.51
153 0.52
154 0.48
155 0.44
156 0.48
157 0.53
158 0.53
159 0.51
160 0.44
161 0.34
162 0.3
163 0.32
164 0.33
165 0.33
166 0.35
167 0.41
168 0.42
169 0.43
170 0.42
171 0.37
172 0.31
173 0.24
174 0.21
175 0.17
176 0.16
177 0.17
178 0.17
179 0.16
180 0.15
181 0.15
182 0.15
183 0.14
184 0.15
185 0.12
186 0.15
187 0.16
188 0.15
189 0.21
190 0.24
191 0.26
192 0.31
193 0.35
194 0.4
195 0.45
196 0.46
197 0.47
198 0.51
199 0.57
200 0.6
201 0.66
202 0.69
203 0.72
204 0.81
205 0.81
206 0.8
207 0.78
208 0.75
209 0.72
210 0.71
211 0.65
212 0.6
213 0.56
214 0.51
215 0.43
216 0.41
217 0.38
218 0.29
219 0.27
220 0.25
221 0.27
222 0.26
223 0.27
224 0.27
225 0.23
226 0.23
227 0.22
228 0.2
229 0.15
230 0.16
231 0.14
232 0.12
233 0.12
234 0.12
235 0.12
236 0.15
237 0.16
238 0.15
239 0.17
240 0.19
241 0.18
242 0.19
243 0.2
244 0.19
245 0.2
246 0.22
247 0.27
248 0.3
249 0.34
250 0.37
251 0.42
252 0.46
253 0.43
254 0.41
255 0.37
256 0.32
257 0.28
258 0.27
259 0.22
260 0.15
261 0.16
262 0.15
263 0.15
264 0.13
265 0.13
266 0.12
267 0.13
268 0.13
269 0.17
270 0.17
271 0.17
272 0.17
273 0.17
274 0.17
275 0.2
276 0.22
277 0.2
278 0.21
279 0.2
280 0.27
281 0.27
282 0.26
283 0.27
284 0.27
285 0.25
286 0.32
287 0.36
288 0.34
289 0.42
290 0.41
291 0.36
292 0.37
293 0.38
294 0.33
295 0.31
296 0.3