Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2A358

Protein Details
Accession A0A0D2A358    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
233-252LVLRSLVKSKPKSNQGKKETHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029062  Class_I_gatase-like  
IPR002818  DJ-1/PfpI  
Pfam View protein in Pfam  
PF01965  DJ-1_PfpI  
Amino Acid Sequences MTSAAKATSLRVGMLLVPPVQLLDASPIDLFGMLSPEYLKACGLPQPLLDLAIPVSLHYISQSGPNSYASMTSDATLPVTDSLTSPGVQPGQLDVLLIPGPDPSLVPDAAVVDFIRAHQKKGTTDFLVICTGSFPAGYAGLLDGKKVTGPRGLVPKLKQKFPAANFVDRRWERDGRLWTSGGITNGLDLTAAYLHHKVQKELADLVCAMADVGDRSQDYESGKAGNTLWWIWLVLRSLVKSKPKSNQGKKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.13
4 0.13
5 0.12
6 0.12
7 0.11
8 0.1
9 0.08
10 0.1
11 0.1
12 0.11
13 0.11
14 0.11
15 0.11
16 0.11
17 0.1
18 0.06
19 0.08
20 0.07
21 0.07
22 0.08
23 0.09
24 0.1
25 0.1
26 0.1
27 0.08
28 0.1
29 0.14
30 0.16
31 0.15
32 0.15
33 0.18
34 0.18
35 0.18
36 0.17
37 0.13
38 0.11
39 0.11
40 0.1
41 0.07
42 0.09
43 0.07
44 0.07
45 0.07
46 0.08
47 0.07
48 0.12
49 0.14
50 0.14
51 0.15
52 0.16
53 0.16
54 0.15
55 0.16
56 0.12
57 0.13
58 0.12
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.09
65 0.07
66 0.07
67 0.07
68 0.07
69 0.09
70 0.09
71 0.1
72 0.1
73 0.11
74 0.11
75 0.11
76 0.1
77 0.09
78 0.09
79 0.08
80 0.08
81 0.06
82 0.07
83 0.07
84 0.06
85 0.06
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.06
99 0.05
100 0.05
101 0.05
102 0.15
103 0.14
104 0.15
105 0.17
106 0.19
107 0.21
108 0.26
109 0.29
110 0.21
111 0.23
112 0.22
113 0.22
114 0.2
115 0.18
116 0.13
117 0.1
118 0.09
119 0.07
120 0.06
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.07
128 0.07
129 0.07
130 0.06
131 0.06
132 0.08
133 0.08
134 0.09
135 0.09
136 0.11
137 0.14
138 0.21
139 0.25
140 0.28
141 0.32
142 0.4
143 0.41
144 0.44
145 0.44
146 0.41
147 0.46
148 0.44
149 0.5
150 0.44
151 0.49
152 0.48
153 0.45
154 0.51
155 0.44
156 0.46
157 0.41
158 0.41
159 0.35
160 0.4
161 0.45
162 0.39
163 0.42
164 0.38
165 0.32
166 0.32
167 0.31
168 0.25
169 0.19
170 0.14
171 0.11
172 0.11
173 0.1
174 0.08
175 0.05
176 0.05
177 0.05
178 0.05
179 0.07
180 0.08
181 0.1
182 0.16
183 0.18
184 0.18
185 0.22
186 0.26
187 0.27
188 0.3
189 0.29
190 0.25
191 0.23
192 0.23
193 0.18
194 0.13
195 0.1
196 0.06
197 0.06
198 0.05
199 0.06
200 0.07
201 0.07
202 0.09
203 0.1
204 0.13
205 0.14
206 0.15
207 0.16
208 0.16
209 0.16
210 0.16
211 0.16
212 0.16
213 0.16
214 0.15
215 0.15
216 0.14
217 0.14
218 0.13
219 0.16
220 0.15
221 0.17
222 0.19
223 0.21
224 0.25
225 0.31
226 0.4
227 0.44
228 0.5
229 0.55
230 0.63
231 0.72
232 0.78