Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9Y813

Protein Details
Accession Q9Y813    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
88-107RVLWICKKCAFKKRFSDKSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:0005829  C:cytosol  
GO:0005655  C:nucleolar ribonuclease P complex  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0004526  F:ribonuclease P activity  
GO:0008033  P:tRNA processing  
KEGG spo:SPBC1105.16c  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MSTKSKDQHARVSYLYQASQLLFRNVQEPTLSRHYISTAKDVSQKSVMRIHPDIKRTICKGCNSLLVPGKSCSIRFEEPSRKNPSIDRVLWICKKCAFKKRFSDKSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.28
4 0.25
5 0.21
6 0.22
7 0.21
8 0.2
9 0.18
10 0.18
11 0.2
12 0.19
13 0.19
14 0.17
15 0.16
16 0.19
17 0.24
18 0.24
19 0.22
20 0.22
21 0.24
22 0.27
23 0.27
24 0.26
25 0.21
26 0.22
27 0.28
28 0.28
29 0.28
30 0.3
31 0.29
32 0.26
33 0.32
34 0.31
35 0.3
36 0.32
37 0.34
38 0.32
39 0.34
40 0.35
41 0.31
42 0.34
43 0.31
44 0.34
45 0.33
46 0.31
47 0.31
48 0.29
49 0.32
50 0.29
51 0.32
52 0.32
53 0.29
54 0.28
55 0.27
56 0.28
57 0.24
58 0.23
59 0.2
60 0.2
61 0.22
62 0.24
63 0.31
64 0.39
65 0.45
66 0.52
67 0.59
68 0.55
69 0.54
70 0.54
71 0.53
72 0.51
73 0.46
74 0.43
75 0.39
76 0.45
77 0.51
78 0.49
79 0.45
80 0.43
81 0.51
82 0.54
83 0.6
84 0.58
85 0.6
86 0.7
87 0.77