Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9UTJ4

Protein Details
Accession Q9UTJ4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-111LQAKLHQKVIDRRRRREKRNKMLKERBasic
NLS Segment(s)
PositionSequence
38-111RMEQKRKLDEIKEREKELKREKEEQRAAHAEKIRTRRQAKADRERMELLQAKLHQKVIDRRRRREKRNKMLKER
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0006364  P:rRNA processing  
KEGG spo:SPAC1556.05c  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MVNGTKGVCVSGKPWKTEKKAYNRSGLADAQRTPYEKRMEQKRKLDEIKEREKELKREKEEQRAAHAEKIRTRRQAKADRERMELLQAKLHQKVIDRRRRREKRNKMLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.53
4 0.62
5 0.67
6 0.68
7 0.74
8 0.75
9 0.76
10 0.68
11 0.65
12 0.59
13 0.54
14 0.46
15 0.39
16 0.35
17 0.3
18 0.3
19 0.3
20 0.28
21 0.3
22 0.32
23 0.32
24 0.38
25 0.46
26 0.54
27 0.6
28 0.67
29 0.68
30 0.7
31 0.71
32 0.69
33 0.67
34 0.65
35 0.66
36 0.61
37 0.56
38 0.55
39 0.54
40 0.57
41 0.57
42 0.58
43 0.53
44 0.59
45 0.61
46 0.64
47 0.66
48 0.59
49 0.55
50 0.53
51 0.5
52 0.46
53 0.46
54 0.39
55 0.39
56 0.45
57 0.45
58 0.48
59 0.5
60 0.51
61 0.56
62 0.62
63 0.67
64 0.7
65 0.74
66 0.69
67 0.7
68 0.66
69 0.57
70 0.54
71 0.49
72 0.39
73 0.35
74 0.36
75 0.35
76 0.35
77 0.37
78 0.32
79 0.33
80 0.42
81 0.47
82 0.54
83 0.59
84 0.68
85 0.77
86 0.86
87 0.9
88 0.91
89 0.92
90 0.93
91 0.94