Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2A5N9

Protein Details
Accession A0A0D2A5N9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
113-132KAMVKFKRGKRKYRTISLETHydrophilic
NLS Segment(s)
PositionSequence
119-123KRGKR
Subcellular Location(s) cyto_nucl 15.166, cyto 13.5, nucl 12.5, cyto_mito 8.165, mito_nucl 7.665
Family & Domain DBs
InterPro View protein in InterPro  
IPR046342  CBS_dom_sf  
Amino Acid Sequences MTHVLEHGVPLGKTIVPNSGGLPPEEDEHTEILSSWADKYRGATVADLDLPPALSTSPSTPLSSAMLSASSHDYSHLTVVSDDTRSLLGYLSIARLKKLFESGELQPSDPVEKAMVKFKRGKRKYRTISLETELYELEGFFENVGPLATGEPQEFAVVTDAGRKFVLGVVTRDDLEMFVKKRPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.16
4 0.17
5 0.18
6 0.21
7 0.2
8 0.2
9 0.21
10 0.18
11 0.19
12 0.2
13 0.19
14 0.16
15 0.16
16 0.16
17 0.14
18 0.13
19 0.12
20 0.11
21 0.1
22 0.1
23 0.13
24 0.14
25 0.14
26 0.16
27 0.18
28 0.2
29 0.2
30 0.19
31 0.16
32 0.18
33 0.19
34 0.16
35 0.13
36 0.11
37 0.1
38 0.09
39 0.08
40 0.06
41 0.05
42 0.06
43 0.08
44 0.12
45 0.13
46 0.14
47 0.14
48 0.15
49 0.16
50 0.15
51 0.13
52 0.09
53 0.09
54 0.08
55 0.09
56 0.1
57 0.1
58 0.09
59 0.1
60 0.1
61 0.1
62 0.11
63 0.1
64 0.07
65 0.07
66 0.08
67 0.09
68 0.08
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.06
75 0.05
76 0.05
77 0.05
78 0.06
79 0.08
80 0.09
81 0.09
82 0.09
83 0.1
84 0.1
85 0.13
86 0.11
87 0.11
88 0.15
89 0.16
90 0.22
91 0.22
92 0.22
93 0.19
94 0.19
95 0.19
96 0.15
97 0.13
98 0.08
99 0.09
100 0.1
101 0.19
102 0.2
103 0.24
104 0.32
105 0.39
106 0.49
107 0.55
108 0.64
109 0.65
110 0.74
111 0.77
112 0.79
113 0.8
114 0.74
115 0.72
116 0.65
117 0.58
118 0.48
119 0.41
120 0.3
121 0.23
122 0.18
123 0.12
124 0.1
125 0.08
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.07
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07
137 0.08
138 0.08
139 0.09
140 0.09
141 0.08
142 0.08
143 0.1
144 0.09
145 0.09
146 0.15
147 0.15
148 0.16
149 0.16
150 0.15
151 0.14
152 0.16
153 0.21
154 0.17
155 0.19
156 0.22
157 0.24
158 0.24
159 0.24
160 0.22
161 0.18
162 0.18
163 0.23
164 0.2