Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2BBH7

Protein Details
Accession A0A0D2BBH7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-74GHPHELKTIRRRRQRVRFKELKNDDBasic
NLS Segment(s)
PositionSequence
59-64RRRRQR
Subcellular Location(s) nucl 10, mito 7, cyto 5, plas 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
Amino Acid Sequences MSIFSVIISSVPHGVTGGIMLDSRNSRMLIAWRSGKLGFPPLSTAVSKSGHPHELKTIRRRRQRVRFKELKNDDIQLMNLARAARVLNVEEIVDLKDTRKVLCRWPNKISSCRSGWLAERRARSMIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.06
6 0.06
7 0.06
8 0.09
9 0.1
10 0.12
11 0.13
12 0.13
13 0.13
14 0.15
15 0.2
16 0.21
17 0.25
18 0.28
19 0.26
20 0.29
21 0.29
22 0.28
23 0.24
24 0.27
25 0.23
26 0.19
27 0.2
28 0.2
29 0.21
30 0.21
31 0.2
32 0.17
33 0.17
34 0.17
35 0.18
36 0.2
37 0.23
38 0.24
39 0.23
40 0.28
41 0.34
42 0.4
43 0.47
44 0.53
45 0.56
46 0.65
47 0.72
48 0.74
49 0.78
50 0.82
51 0.82
52 0.82
53 0.83
54 0.79
55 0.81
56 0.76
57 0.7
58 0.61
59 0.53
60 0.44
61 0.35
62 0.3
63 0.22
64 0.17
65 0.12
66 0.12
67 0.1
68 0.09
69 0.09
70 0.09
71 0.07
72 0.08
73 0.09
74 0.08
75 0.08
76 0.09
77 0.08
78 0.08
79 0.08
80 0.09
81 0.08
82 0.08
83 0.12
84 0.12
85 0.14
86 0.2
87 0.22
88 0.31
89 0.4
90 0.49
91 0.52
92 0.59
93 0.66
94 0.66
95 0.72
96 0.68
97 0.65
98 0.59
99 0.55
100 0.51
101 0.45
102 0.46
103 0.48
104 0.5
105 0.5
106 0.52
107 0.52