FuNGI

O94547

Protein Details

Accession

O94547

Localization Confidence

Medium

Confidence Score

12.3

NoLS Segment(s)

Position	Sequence	Protein Nature
77-96	PSEYSRSKCKQPTNEKEYDK	Hydrophilic
546-566	QSQQQSSQRSRNKFKGFQLNL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 19.5, cyto_nucl 12.5, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR011009 Kinase-like_dom_sf IPR000719 Prot_kinase_dom IPR008271 Ser/Thr_kinase_AS
Gene Ontology	GO:0042764 C:ascospore-type prospore GO:0005737 C:cytoplasm GO:0005730 C:nucleolus GO:0005634 C:nucleus GO:0005524 F:ATP binding GO:0106310 F:protein serine kinase activity GO:0004674 F:protein serine/threonine kinase activity GO:0071470 P:cellular response to osmotic stress GO:0034599 P:cellular response to oxidative stress GO:0051321 P:meiotic cell cycle GO:0044773 P:mitotic DNA damage checkpoint signaling GO:0010972 P:negative regulation of G2/M transition of mitotic cell cycle GO:0010515 P:negative regulation of induction of conjugation with cellular fusion GO:1900181 P:negative regulation of protein localization to nucleus GO:0032092 P:positive regulation of protein binding GO:0006468 P:protein phosphorylation
KEGG	spo:SPCC1322.08 -
Pfam	View protein in Pfam PF00069 Pkinase
PROSITE	View protein in PROSITE PS50011 PROTEIN_KINASE_DOM PS00108 PROTEIN_KINASE_ST
CDD	cd14096 STKc_RCK1-like

Amino Acid Sequences

MRFKSIQQNIEDEGKVNVREVNPDSYAERDHGYTAGIFSDAEENFGITQQVADSTQNPTSKPKSRHAHFHETVHENPSEYSRSKCKQPTNEKEYDKAIEALVAKAIVEEHSGQQFPVYKGLEQYTLLQKMGDGAFSNVYKAIHNRTGEKVAIKVVQRAQPNTDPRDPRKRQGVESHNILKEVQIMRRVKHPNIIQLLEFIQTPEYYYLVLELADGGELFHQIVRLTYFSEDLSRHVITQVAHAIRYLHEDCGVVHRDIKPENLLFDSIDFVPSRVRKYRAGDDPDKVDEGEFIPGVGAGTIGRIRLADFGLSKVVWDSHTQTPCGTMGYTAPEIVRDERYSKGVDMWALGCVLYTILCGFPPFYDESISLLTKKVSRGEYSFLSPWWDDISKSAKDLISHLLTVDPESRYDIHQFLAHPWISGSREPTFPATDAPNTAQRENPFTYDFLEPEDVAAAGSAARTPGVNSLREVFNISYAAHRMEQEKIRKRGQRGNQGIMNFMGDMDDLMEENDDYDDGTKSVEHSMKRVNLSGENDPSLASRQPAQSQQQSSQRSRNKFKGFQLNLSKATLYNRRHRQKV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.31
2	0.28
3	0.25
4	0.26
5	0.21
6	0.27
7	0.3
8	0.31
9	0.29
10	0.31
11	0.31
12	0.3
13	0.31
14	0.26
15	0.25
16	0.2
17	0.2
18	0.18
19	0.18
20	0.15
21	0.14
22	0.13
23	0.11
24	0.1
25	0.1
26	0.15
27	0.13
28	0.14
29	0.14
30	0.14
31	0.14
32	0.14
33	0.14
34	0.08
35	0.09
36	0.07
37	0.08
38	0.09
39	0.11
40	0.12
41	0.16
42	0.21
43	0.23
44	0.25
45	0.3
46	0.37
47	0.45
48	0.49
49	0.55
50	0.6
51	0.64
52	0.73
53	0.75
54	0.78
55	0.73
56	0.72
57	0.71
58	0.66
59	0.63
60	0.56
61	0.48
62	0.38
63	0.34
64	0.32
65	0.29
66	0.25
67	0.27
68	0.32
69	0.36
70	0.44
71	0.51
72	0.57
73	0.63
74	0.72
75	0.78
76	0.78
77	0.83
78	0.78
79	0.73
80	0.69
81	0.61
82	0.51
83	0.42
84	0.32
85	0.26
86	0.23
87	0.2
88	0.16
89	0.13
90	0.11
91	0.1
92	0.1
93	0.07
94	0.08
95	0.09
96	0.11
97	0.14
98	0.14
99	0.14
100	0.16
101	0.21
102	0.2
103	0.25
104	0.24
105	0.21
106	0.24
107	0.26
108	0.25
109	0.21
110	0.24
111	0.26
112	0.26
113	0.25
114	0.23
115	0.2
116	0.22
117	0.21
118	0.18
119	0.12
120	0.11
121	0.14
122	0.14
123	0.15
124	0.13
125	0.13
126	0.14
127	0.16
128	0.21
129	0.24
130	0.26
131	0.28
132	0.31
133	0.34
134	0.35
135	0.33
136	0.28
137	0.25
138	0.28
139	0.26
140	0.27
141	0.29
142	0.32
143	0.35
144	0.36
145	0.38
146	0.41
147	0.46
148	0.47
149	0.5
150	0.53
151	0.56
152	0.65
153	0.64
154	0.64
155	0.67
156	0.65
157	0.63
158	0.65
159	0.66
160	0.6
161	0.63
162	0.64
163	0.54
164	0.51
165	0.45
166	0.35
167	0.33
168	0.3
169	0.26
170	0.26
171	0.28
172	0.28
173	0.37
174	0.42
175	0.38
176	0.42
177	0.42
178	0.42
179	0.44
180	0.44
181	0.36
182	0.32
183	0.31
184	0.24
185	0.21
186	0.14
187	0.1
188	0.08
189	0.09
190	0.08
191	0.08
192	0.07
193	0.07
194	0.07
195	0.06
196	0.06
197	0.05
198	0.04
199	0.04
200	0.04
201	0.04
202	0.03
203	0.03
204	0.03
205	0.04
206	0.04
207	0.04
208	0.04
209	0.05
210	0.06
211	0.06
212	0.07
213	0.08
214	0.08
215	0.08
216	0.11
217	0.11
218	0.11
219	0.15
220	0.14
221	0.14
222	0.13
223	0.15
224	0.13
225	0.14
226	0.18
227	0.15
228	0.15
229	0.15
230	0.15
231	0.13
232	0.18
233	0.17
234	0.12
235	0.13
236	0.13
237	0.13
238	0.17
239	0.19
240	0.14
241	0.16
242	0.17
243	0.19
244	0.2
245	0.21
246	0.19
247	0.16
248	0.17
249	0.15
250	0.14
251	0.12
252	0.11
253	0.12
254	0.09
255	0.1
256	0.08
257	0.08
258	0.11
259	0.13
260	0.17
261	0.19
262	0.22
263	0.26
264	0.3
265	0.38
266	0.42
267	0.47
268	0.47
269	0.45
270	0.45
271	0.42
272	0.37
273	0.3
274	0.22
275	0.15
276	0.12
277	0.1
278	0.07
279	0.06
280	0.05
281	0.05
282	0.05
283	0.04
284	0.03
285	0.02
286	0.03
287	0.04
288	0.04
289	0.04
290	0.04
291	0.05
292	0.06
293	0.06
294	0.06
295	0.06
296	0.07
297	0.08
298	0.08
299	0.08
300	0.07
301	0.07
302	0.07
303	0.08
304	0.13
305	0.18
306	0.2
307	0.2
308	0.2
309	0.21
310	0.2
311	0.19
312	0.14
313	0.08
314	0.07
315	0.1
316	0.1
317	0.1
318	0.09
319	0.09
320	0.11
321	0.12
322	0.13
323	0.12
324	0.14
325	0.14
326	0.16
327	0.17
328	0.16
329	0.16
330	0.14
331	0.13
332	0.12
333	0.11
334	0.1
335	0.09
336	0.08
337	0.06
338	0.05
339	0.05
340	0.04
341	0.03
342	0.03
343	0.04
344	0.04
345	0.04
346	0.05
347	0.05
348	0.07
349	0.08
350	0.09
351	0.1
352	0.1
353	0.12
354	0.14
355	0.15
356	0.13
357	0.12
358	0.13
359	0.14
360	0.16
361	0.19
362	0.18
363	0.21
364	0.22
365	0.25
366	0.26
367	0.28
368	0.27
369	0.22
370	0.23
371	0.2
372	0.19
373	0.18
374	0.17
375	0.13
376	0.15
377	0.2
378	0.18
379	0.18
380	0.21
381	0.19
382	0.19
383	0.2
384	0.22
385	0.18
386	0.18
387	0.17
388	0.15
389	0.14
390	0.15
391	0.17
392	0.12
393	0.11
394	0.13
395	0.14
396	0.15
397	0.17
398	0.17
399	0.15
400	0.17
401	0.17
402	0.17
403	0.22
404	0.2
405	0.18
406	0.17
407	0.19
408	0.19
409	0.21
410	0.23
411	0.19
412	0.2
413	0.21
414	0.24
415	0.23
416	0.21
417	0.21
418	0.2
419	0.19
420	0.21
421	0.22
422	0.26
423	0.27
424	0.28
425	0.29
426	0.28
427	0.32
428	0.32
429	0.32
430	0.27
431	0.25
432	0.27
433	0.24
434	0.23
435	0.2
436	0.2
437	0.17
438	0.15
439	0.15
440	0.12
441	0.1
442	0.09
443	0.06
444	0.04
445	0.04
446	0.04
447	0.04
448	0.04
449	0.05
450	0.05
451	0.13
452	0.16
453	0.17
454	0.18
455	0.22
456	0.23
457	0.24
458	0.26
459	0.2
460	0.18
461	0.18
462	0.17
463	0.16
464	0.16
465	0.18
466	0.16
467	0.17
468	0.18
469	0.23
470	0.3
471	0.38
472	0.47
473	0.51
474	0.59
475	0.64
476	0.69
477	0.73
478	0.75
479	0.76
480	0.74
481	0.75
482	0.71
483	0.64
484	0.59
485	0.49
486	0.41
487	0.29
488	0.21
489	0.13
490	0.09
491	0.08
492	0.06
493	0.06
494	0.05
495	0.05
496	0.06
497	0.06
498	0.06
499	0.07
500	0.06
501	0.06
502	0.07
503	0.08
504	0.08
505	0.08
506	0.08
507	0.09
508	0.16
509	0.21
510	0.2
511	0.24
512	0.32
513	0.37
514	0.4
515	0.42
516	0.39
517	0.4
518	0.44
519	0.47
520	0.43
521	0.39
522	0.36
523	0.33
524	0.31
525	0.28
526	0.25
527	0.2
528	0.2
529	0.23
530	0.28
531	0.35
532	0.41
533	0.47
534	0.5
535	0.56
536	0.6
537	0.64
538	0.66
539	0.69
540	0.7
541	0.71
542	0.76
543	0.78
544	0.79
545	0.79
546	0.81
547	0.82
548	0.79
549	0.79
550	0.79
551	0.76
552	0.69
553	0.64
554	0.55
555	0.46
556	0.48
557	0.48
558	0.45
559	0.49
560	0.56

O94547

3D AlphaFold-predicted Structure Viewer