Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O94547

Protein Details
Accession O94547    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-96PSEYSRSKCKQPTNEKEYDKHydrophilic
546-566QSQQQSSQRSRNKFKGFQLNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0042764  C:ascospore-type prospore  
GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0106310  F:protein serine kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0071470  P:cellular response to osmotic stress  
GO:0034599  P:cellular response to oxidative stress  
GO:0051321  P:meiotic cell cycle  
GO:0044773  P:mitotic DNA damage checkpoint signaling  
GO:0010972  P:negative regulation of G2/M transition of mitotic cell cycle  
GO:0010515  P:negative regulation of induction of conjugation with cellular fusion  
GO:1900181  P:negative regulation of protein localization to nucleus  
GO:0032092  P:positive regulation of protein binding  
GO:0006468  P:protein phosphorylation  
KEGG spo:SPCC1322.08  -  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd14096  STKc_RCK1-like  
Amino Acid Sequences MRFKSIQQNIEDEGKVNVREVNPDSYAERDHGYTAGIFSDAEENFGITQQVADSTQNPTSKPKSRHAHFHETVHENPSEYSRSKCKQPTNEKEYDKAIEALVAKAIVEEHSGQQFPVYKGLEQYTLLQKMGDGAFSNVYKAIHNRTGEKVAIKVVQRAQPNTDPRDPRKRQGVESHNILKEVQIMRRVKHPNIIQLLEFIQTPEYYYLVLELADGGELFHQIVRLTYFSEDLSRHVITQVAHAIRYLHEDCGVVHRDIKPENLLFDSIDFVPSRVRKYRAGDDPDKVDEGEFIPGVGAGTIGRIRLADFGLSKVVWDSHTQTPCGTMGYTAPEIVRDERYSKGVDMWALGCVLYTILCGFPPFYDESISLLTKKVSRGEYSFLSPWWDDISKSAKDLISHLLTVDPESRYDIHQFLAHPWISGSREPTFPATDAPNTAQRENPFTYDFLEPEDVAAAGSAARTPGVNSLREVFNISYAAHRMEQEKIRKRGQRGNQGIMNFMGDMDDLMEENDDYDDGTKSVEHSMKRVNLSGENDPSLASRQPAQSQQQSSQRSRNKFKGFQLNLSKATLYNRRHRQKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.25
4 0.26
5 0.21
6 0.27
7 0.3
8 0.31
9 0.29
10 0.31
11 0.31
12 0.3
13 0.31
14 0.26
15 0.25
16 0.2
17 0.2
18 0.18
19 0.18
20 0.15
21 0.14
22 0.13
23 0.11
24 0.1
25 0.1
26 0.15
27 0.13
28 0.14
29 0.14
30 0.14
31 0.14
32 0.14
33 0.14
34 0.08
35 0.09
36 0.07
37 0.08
38 0.09
39 0.11
40 0.12
41 0.16
42 0.21
43 0.23
44 0.25
45 0.3
46 0.37
47 0.45
48 0.49
49 0.55
50 0.6
51 0.64
52 0.73
53 0.75
54 0.78
55 0.73
56 0.72
57 0.71
58 0.66
59 0.63
60 0.56
61 0.48
62 0.38
63 0.34
64 0.32
65 0.29
66 0.25
67 0.27
68 0.32
69 0.36
70 0.44
71 0.51
72 0.57
73 0.63
74 0.72
75 0.78
76 0.78
77 0.83
78 0.78
79 0.73
80 0.69
81 0.61
82 0.51
83 0.42
84 0.32
85 0.26
86 0.23
87 0.2
88 0.16
89 0.13
90 0.11
91 0.1
92 0.1
93 0.07
94 0.08
95 0.09
96 0.11
97 0.14
98 0.14
99 0.14
100 0.16
101 0.21
102 0.2
103 0.25
104 0.24
105 0.21
106 0.24
107 0.26
108 0.25
109 0.21
110 0.24
111 0.26
112 0.26
113 0.25
114 0.23
115 0.2
116 0.22
117 0.21
118 0.18
119 0.12
120 0.11
121 0.14
122 0.14
123 0.15
124 0.13
125 0.13
126 0.14
127 0.16
128 0.21
129 0.24
130 0.26
131 0.28
132 0.31
133 0.34
134 0.35
135 0.33
136 0.28
137 0.25
138 0.28
139 0.26
140 0.27
141 0.29
142 0.32
143 0.35
144 0.36
145 0.38
146 0.41
147 0.46
148 0.47
149 0.5
150 0.53
151 0.56
152 0.65
153 0.64
154 0.64
155 0.67
156 0.65
157 0.63
158 0.65
159 0.66
160 0.6
161 0.63
162 0.64
163 0.54
164 0.51
165 0.45
166 0.35
167 0.33
168 0.3
169 0.26
170 0.26
171 0.28
172 0.28
173 0.37
174 0.42
175 0.38
176 0.42
177 0.42
178 0.42
179 0.44
180 0.44
181 0.36
182 0.32
183 0.31
184 0.24
185 0.21
186 0.14
187 0.1
188 0.08
189 0.09
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.06
196 0.06
197 0.05
198 0.04
199 0.04
200 0.04
201 0.04
202 0.03
203 0.03
204 0.03
205 0.04
206 0.04
207 0.04
208 0.04
209 0.05
210 0.06
211 0.06
212 0.07
213 0.08
214 0.08
215 0.08
216 0.11
217 0.11
218 0.11
219 0.15
220 0.14
221 0.14
222 0.13
223 0.15
224 0.13
225 0.14
226 0.18
227 0.15
228 0.15
229 0.15
230 0.15
231 0.13
232 0.18
233 0.17
234 0.12
235 0.13
236 0.13
237 0.13
238 0.17
239 0.19
240 0.14
241 0.16
242 0.17
243 0.19
244 0.2
245 0.21
246 0.19
247 0.16
248 0.17
249 0.15
250 0.14
251 0.12
252 0.11
253 0.12
254 0.09
255 0.1
256 0.08
257 0.08
258 0.11
259 0.13
260 0.17
261 0.19
262 0.22
263 0.26
264 0.3
265 0.38
266 0.42
267 0.47
268 0.47
269 0.45
270 0.45
271 0.42
272 0.37
273 0.3
274 0.22
275 0.15
276 0.12
277 0.1
278 0.07
279 0.06
280 0.05
281 0.05
282 0.05
283 0.04
284 0.03
285 0.02
286 0.03
287 0.04
288 0.04
289 0.04
290 0.04
291 0.05
292 0.06
293 0.06
294 0.06
295 0.06
296 0.07
297 0.08
298 0.08
299 0.08
300 0.07
301 0.07
302 0.07
303 0.08
304 0.13
305 0.18
306 0.2
307 0.2
308 0.2
309 0.21
310 0.2
311 0.19
312 0.14
313 0.08
314 0.07
315 0.1
316 0.1
317 0.1
318 0.09
319 0.09
320 0.11
321 0.12
322 0.13
323 0.12
324 0.14
325 0.14
326 0.16
327 0.17
328 0.16
329 0.16
330 0.14
331 0.13
332 0.12
333 0.11
334 0.1
335 0.09
336 0.08
337 0.06
338 0.05
339 0.05
340 0.04
341 0.03
342 0.03
343 0.04
344 0.04
345 0.04
346 0.05
347 0.05
348 0.07
349 0.08
350 0.09
351 0.1
352 0.1
353 0.12
354 0.14
355 0.15
356 0.13
357 0.12
358 0.13
359 0.14
360 0.16
361 0.19
362 0.18
363 0.21
364 0.22
365 0.25
366 0.26
367 0.28
368 0.27
369 0.22
370 0.23
371 0.2
372 0.19
373 0.18
374 0.17
375 0.13
376 0.15
377 0.2
378 0.18
379 0.18
380 0.21
381 0.19
382 0.19
383 0.2
384 0.22
385 0.18
386 0.18
387 0.17
388 0.15
389 0.14
390 0.15
391 0.17
392 0.12
393 0.11
394 0.13
395 0.14
396 0.15
397 0.17
398 0.17
399 0.15
400 0.17
401 0.17
402 0.17
403 0.22
404 0.2
405 0.18
406 0.17
407 0.19
408 0.19
409 0.21
410 0.23
411 0.19
412 0.2
413 0.21
414 0.24
415 0.23
416 0.21
417 0.21
418 0.2
419 0.19
420 0.21
421 0.22
422 0.26
423 0.27
424 0.28
425 0.29
426 0.28
427 0.32
428 0.32
429 0.32
430 0.27
431 0.25
432 0.27
433 0.24
434 0.23
435 0.2
436 0.2
437 0.17
438 0.15
439 0.15
440 0.12
441 0.1
442 0.09
443 0.06
444 0.04
445 0.04
446 0.04
447 0.04
448 0.04
449 0.05
450 0.05
451 0.13
452 0.16
453 0.17
454 0.18
455 0.22
456 0.23
457 0.24
458 0.26
459 0.2
460 0.18
461 0.18
462 0.17
463 0.16
464 0.16
465 0.18
466 0.16
467 0.17
468 0.18
469 0.23
470 0.3
471 0.38
472 0.47
473 0.51
474 0.59
475 0.64
476 0.69
477 0.73
478 0.75
479 0.76
480 0.74
481 0.75
482 0.71
483 0.64
484 0.59
485 0.49
486 0.41
487 0.29
488 0.21
489 0.13
490 0.09
491 0.08
492 0.06
493 0.06
494 0.05
495 0.05
496 0.06
497 0.06
498 0.06
499 0.07
500 0.06
501 0.06
502 0.07
503 0.08
504 0.08
505 0.08
506 0.08
507 0.09
508 0.16
509 0.21
510 0.2
511 0.24
512 0.32
513 0.37
514 0.4
515 0.42
516 0.39
517 0.4
518 0.44
519 0.47
520 0.43
521 0.39
522 0.36
523 0.33
524 0.31
525 0.28
526 0.25
527 0.2
528 0.2
529 0.23
530 0.28
531 0.35
532 0.41
533 0.47
534 0.5
535 0.56
536 0.6
537 0.64
538 0.66
539 0.69
540 0.7
541 0.71
542 0.76
543 0.78
544 0.79
545 0.79
546 0.81
547 0.82
548 0.79
549 0.79
550 0.79
551 0.76
552 0.69
553 0.64
554 0.55
555 0.46
556 0.48
557 0.48
558 0.45
559 0.49
560 0.56