Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O42667

Protein Details
Accession O42667   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-113SNFMEKTKAIKQKSRREPSKFERSLHydrophilic
273-295QKEIKYLRKRKLQIRKIPNYKYSHydrophilic
NLS Segment(s)
PositionSequence
98-104IKQKSRR
256-287KPRNFRREKFLKKFLAMQKEIKYLRKRKLQIR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036859  CAP-Gly_dom_sf  
IPR000938  CAP-Gly_domain  
Gene Ontology GO:0051285  C:cell cortex of cell tip  
GO:0051286  C:cell tip  
GO:1903754  C:cortical microtubule plus-end  
GO:0005881  C:cytoplasmic microtubule  
GO:0005869  C:dynactin complex  
GO:0035974  C:meiotic spindle pole body  
GO:0005875  C:microtubule associated complex  
GO:0015630  C:microtubule cytoskeleton  
GO:0072686  C:mitotic spindle  
GO:0110092  C:nucleus leading edge  
GO:0005819  C:spindle  
GO:0005816  C:spindle pole body  
GO:0030989  P:dynein-driven meiotic oscillatory nuclear movement  
GO:0007127  P:meiosis I  
GO:0000743  P:nuclear migration involved in conjugation with cellular fusion  
KEGG spo:SPAC27D7.13c  -  
Pfam View protein in Pfam  
PF01302  CAP_GLY  
PROSITE View protein in PROSITE  
PS00845  CAP_GLY_1  
PS50245  CAP_GLY_2  
Amino Acid Sequences MSYLSVGDEVLIRGELGIVRFAGSTDFESGIWLGVELLNGKGKNDGSVKGKRYFSCEKGKGIFVRACSSNVMKRPSVVKSRKKGSENISNFMEKTKAIKQKSRREPSKFERSLARPLCITPIDSSTPTKTATFYTSSTTENLDELNFSTEELSSFDTTLLNSDTSKLSGLDDSSFMEEEFVWQVDNVLQECEKKFTPHSKGSYLKENLKSELRKGRLDELMCENTALKEKIDKLNKELEKVEPQLTFLRSKNSIEKPRNFRREKFLKKFLAMQKEIKYLRKRKLQIRKIPNYKYSDRSLNSKTPKSQDNWTTQVTPSSLLGVSEVSKVLQLKQVQVDITELVKIPKNPFSEKLTISNVNRYLNIVPGSLDLQFSLTNENFVHWNSTVYQELLNLKSNNSSVDGVKTRRQLLEENALLSHKVLKLTEEIQDLETLNQLNTEIEARQSEKLNEVQEETQRLSQLLISSQPALTEVKHLKLCLSDSQEELLQLNAKLEKANIVIDELNSAKLKLSKQVEEESSMKDDLTEMNQRLKEQIESYENEVNSEITSRTLKEFETLKTQYEKNLCNLREQLKTARMKLADKYPQGDNTSENIDWLKHSLRDSNTENSIPSPLTFACKEIRKLVADIKPVSVEKQLALNWKKDIERPSFHHNQQLFNYCQLTDILSKKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.09
4 0.1
5 0.1
6 0.1
7 0.1
8 0.11
9 0.11
10 0.11
11 0.12
12 0.14
13 0.15
14 0.14
15 0.15
16 0.15
17 0.14
18 0.12
19 0.1
20 0.08
21 0.08
22 0.09
23 0.08
24 0.1
25 0.15
26 0.15
27 0.15
28 0.19
29 0.19
30 0.23
31 0.26
32 0.29
33 0.32
34 0.4
35 0.46
36 0.5
37 0.56
38 0.52
39 0.56
40 0.59
41 0.59
42 0.61
43 0.6
44 0.6
45 0.57
46 0.62
47 0.57
48 0.56
49 0.52
50 0.43
51 0.44
52 0.39
53 0.37
54 0.35
55 0.36
56 0.36
57 0.4
58 0.42
59 0.38
60 0.39
61 0.43
62 0.46
63 0.52
64 0.55
65 0.59
66 0.63
67 0.72
68 0.77
69 0.76
70 0.76
71 0.73
72 0.74
73 0.69
74 0.65
75 0.59
76 0.53
77 0.49
78 0.43
79 0.37
80 0.26
81 0.26
82 0.3
83 0.34
84 0.39
85 0.47
86 0.55
87 0.65
88 0.75
89 0.81
90 0.82
91 0.82
92 0.85
93 0.86
94 0.87
95 0.79
96 0.72
97 0.7
98 0.64
99 0.67
100 0.6
101 0.53
102 0.43
103 0.41
104 0.42
105 0.34
106 0.31
107 0.23
108 0.23
109 0.24
110 0.25
111 0.27
112 0.25
113 0.26
114 0.26
115 0.25
116 0.22
117 0.21
118 0.22
119 0.22
120 0.2
121 0.22
122 0.23
123 0.24
124 0.24
125 0.23
126 0.2
127 0.18
128 0.17
129 0.13
130 0.12
131 0.11
132 0.13
133 0.11
134 0.1
135 0.11
136 0.1
137 0.1
138 0.11
139 0.13
140 0.1
141 0.11
142 0.11
143 0.11
144 0.1
145 0.12
146 0.12
147 0.1
148 0.09
149 0.11
150 0.11
151 0.11
152 0.12
153 0.11
154 0.1
155 0.11
156 0.12
157 0.11
158 0.11
159 0.12
160 0.12
161 0.12
162 0.11
163 0.11
164 0.09
165 0.1
166 0.1
167 0.09
168 0.08
169 0.07
170 0.08
171 0.08
172 0.1
173 0.09
174 0.09
175 0.1
176 0.13
177 0.15
178 0.18
179 0.17
180 0.18
181 0.22
182 0.3
183 0.36
184 0.41
185 0.44
186 0.48
187 0.54
188 0.55
189 0.6
190 0.56
191 0.57
192 0.56
193 0.54
194 0.5
195 0.51
196 0.49
197 0.46
198 0.5
199 0.46
200 0.42
201 0.42
202 0.44
203 0.42
204 0.41
205 0.37
206 0.35
207 0.34
208 0.3
209 0.28
210 0.23
211 0.19
212 0.22
213 0.19
214 0.13
215 0.15
216 0.18
217 0.26
218 0.33
219 0.34
220 0.33
221 0.42
222 0.43
223 0.42
224 0.41
225 0.36
226 0.34
227 0.36
228 0.35
229 0.26
230 0.27
231 0.27
232 0.28
233 0.28
234 0.23
235 0.25
236 0.24
237 0.26
238 0.32
239 0.37
240 0.45
241 0.5
242 0.57
243 0.62
244 0.71
245 0.79
246 0.76
247 0.71
248 0.71
249 0.73
250 0.76
251 0.74
252 0.73
253 0.67
254 0.64
255 0.69
256 0.65
257 0.63
258 0.56
259 0.53
260 0.47
261 0.5
262 0.51
263 0.5
264 0.53
265 0.52
266 0.56
267 0.6
268 0.63
269 0.66
270 0.74
271 0.77
272 0.77
273 0.8
274 0.83
275 0.83
276 0.82
277 0.79
278 0.75
279 0.68
280 0.63
281 0.56
282 0.52
283 0.45
284 0.45
285 0.43
286 0.44
287 0.46
288 0.46
289 0.46
290 0.43
291 0.45
292 0.42
293 0.44
294 0.43
295 0.42
296 0.42
297 0.4
298 0.38
299 0.34
300 0.33
301 0.27
302 0.21
303 0.15
304 0.12
305 0.1
306 0.08
307 0.08
308 0.07
309 0.07
310 0.07
311 0.07
312 0.05
313 0.07
314 0.07
315 0.08
316 0.12
317 0.12
318 0.13
319 0.14
320 0.16
321 0.14
322 0.14
323 0.14
324 0.11
325 0.1
326 0.09
327 0.08
328 0.08
329 0.09
330 0.11
331 0.12
332 0.17
333 0.19
334 0.21
335 0.24
336 0.28
337 0.3
338 0.3
339 0.32
340 0.3
341 0.33
342 0.31
343 0.34
344 0.31
345 0.28
346 0.27
347 0.25
348 0.21
349 0.18
350 0.18
351 0.13
352 0.11
353 0.1
354 0.11
355 0.1
356 0.09
357 0.07
358 0.07
359 0.07
360 0.07
361 0.1
362 0.08
363 0.1
364 0.1
365 0.1
366 0.1
367 0.11
368 0.13
369 0.1
370 0.11
371 0.1
372 0.12
373 0.12
374 0.12
375 0.12
376 0.11
377 0.13
378 0.14
379 0.18
380 0.17
381 0.16
382 0.17
383 0.18
384 0.16
385 0.16
386 0.16
387 0.11
388 0.15
389 0.19
390 0.21
391 0.25
392 0.28
393 0.28
394 0.28
395 0.29
396 0.28
397 0.28
398 0.33
399 0.29
400 0.26
401 0.24
402 0.23
403 0.21
404 0.19
405 0.18
406 0.11
407 0.11
408 0.1
409 0.11
410 0.13
411 0.15
412 0.18
413 0.16
414 0.16
415 0.15
416 0.16
417 0.16
418 0.14
419 0.13
420 0.11
421 0.09
422 0.08
423 0.08
424 0.06
425 0.07
426 0.08
427 0.06
428 0.07
429 0.09
430 0.11
431 0.13
432 0.15
433 0.15
434 0.17
435 0.2
436 0.21
437 0.2
438 0.21
439 0.21
440 0.22
441 0.24
442 0.24
443 0.22
444 0.2
445 0.19
446 0.17
447 0.16
448 0.14
449 0.12
450 0.12
451 0.12
452 0.12
453 0.12
454 0.11
455 0.11
456 0.11
457 0.1
458 0.16
459 0.17
460 0.2
461 0.22
462 0.22
463 0.21
464 0.22
465 0.24
466 0.23
467 0.26
468 0.24
469 0.23
470 0.24
471 0.24
472 0.23
473 0.21
474 0.16
475 0.13
476 0.11
477 0.12
478 0.12
479 0.11
480 0.11
481 0.11
482 0.13
483 0.12
484 0.13
485 0.11
486 0.12
487 0.12
488 0.12
489 0.14
490 0.12
491 0.13
492 0.13
493 0.13
494 0.12
495 0.15
496 0.16
497 0.22
498 0.26
499 0.27
500 0.31
501 0.36
502 0.36
503 0.38
504 0.38
505 0.34
506 0.32
507 0.28
508 0.24
509 0.19
510 0.18
511 0.14
512 0.17
513 0.21
514 0.2
515 0.26
516 0.28
517 0.29
518 0.3
519 0.3
520 0.28
521 0.23
522 0.26
523 0.24
524 0.25
525 0.3
526 0.33
527 0.31
528 0.29
529 0.28
530 0.23
531 0.19
532 0.18
533 0.14
534 0.11
535 0.13
536 0.13
537 0.15
538 0.16
539 0.16
540 0.19
541 0.22
542 0.22
543 0.3
544 0.3
545 0.31
546 0.35
547 0.35
548 0.38
549 0.42
550 0.42
551 0.41
552 0.48
553 0.45
554 0.46
555 0.52
556 0.51
557 0.49
558 0.5
559 0.49
560 0.49
561 0.54
562 0.51
563 0.51
564 0.49
565 0.47
566 0.49
567 0.51
568 0.51
569 0.49
570 0.49
571 0.47
572 0.49
573 0.49
574 0.45
575 0.38
576 0.32
577 0.34
578 0.3
579 0.27
580 0.22
581 0.2
582 0.2
583 0.21
584 0.22
585 0.2
586 0.22
587 0.28
588 0.3
589 0.36
590 0.4
591 0.42
592 0.43
593 0.41
594 0.39
595 0.34
596 0.34
597 0.27
598 0.23
599 0.2
600 0.16
601 0.2
602 0.2
603 0.21
604 0.26
605 0.32
606 0.35
607 0.37
608 0.41
609 0.39
610 0.42
611 0.48
612 0.47
613 0.47
614 0.46
615 0.43
616 0.42
617 0.4
618 0.39
619 0.34
620 0.29
621 0.23
622 0.26
623 0.27
624 0.33
625 0.36
626 0.38
627 0.37
628 0.41
629 0.43
630 0.44
631 0.49
632 0.47
633 0.51
634 0.52
635 0.58
636 0.62
637 0.62
638 0.66
639 0.61
640 0.59
641 0.59
642 0.61
643 0.55
644 0.5
645 0.49
646 0.39
647 0.38
648 0.32
649 0.28
650 0.26