FuNGI

O42667

Protein Details

Accession

O42667

Localization Confidence

High

Confidence Score

18.1

NoLS Segment(s)

Position	Sequence	Protein Nature
89-113	SNFMEKTKAIKQKSRREPSKFERSL	Hydrophilic
273-295	QKEIKYLRKRKLQIRKIPNYKYS	Hydrophilic

NLS Segment(s)

Position	Sequence
98-104	IKQKSRR
256-287	KPRNFRREKFLKKFLAMQKEIKYLRKRKLQIR

Subcellular Location(s)

nucl 23, cyto_nucl 14.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036859 CAP-Gly_dom_sf IPR000938 CAP-Gly_domain
Gene Ontology	GO:0051285 C:cell cortex of cell tip GO:0051286 C:cell tip GO:1903754 C:cortical microtubule plus-end GO:0005881 C:cytoplasmic microtubule GO:0005869 C:dynactin complex GO:0035974 C:meiotic spindle pole body GO:0005875 C:microtubule associated complex GO:0015630 C:microtubule cytoskeleton GO:0072686 C:mitotic spindle GO:0110092 C:nucleus leading edge GO:0005819 C:spindle GO:0005816 C:spindle pole body GO:0030989 P:dynein-driven meiotic oscillatory nuclear movement GO:0007127 P:meiosis I GO:0000743 P:nuclear migration involved in conjugation with cellular fusion
KEGG	spo:SPAC27D7.13c -
Pfam	View protein in Pfam PF01302 CAP_GLY
PROSITE	View protein in PROSITE PS00845 CAP_GLY_1 PS50245 CAP_GLY_2

Amino Acid Sequences

MSYLSVGDEVLIRGELGIVRFAGSTDFESGIWLGVELLNGKGKNDGSVKGKRYFSCEKGKGIFVRACSSNVMKRPSVVKSRKKGSENISNFMEKTKAIKQKSRREPSKFERSLARPLCITPIDSSTPTKTATFYTSSTTENLDELNFSTEELSSFDTTLLNSDTSKLSGLDDSSFMEEEFVWQVDNVLQECEKKFTPHSKGSYLKENLKSELRKGRLDELMCENTALKEKIDKLNKELEKVEPQLTFLRSKNSIEKPRNFRREKFLKKFLAMQKEIKYLRKRKLQIRKIPNYKYSDRSLNSKTPKSQDNWTTQVTPSSLLGVSEVSKVLQLKQVQVDITELVKIPKNPFSEKLTISNVNRYLNIVPGSLDLQFSLTNENFVHWNSTVYQELLNLKSNNSSVDGVKTRRQLLEENALLSHKVLKLTEEIQDLETLNQLNTEIEARQSEKLNEVQEETQRLSQLLISSQPALTEVKHLKLCLSDSQEELLQLNAKLEKANIVIDELNSAKLKLSKQVEEESSMKDDLTEMNQRLKEQIESYENEVNSEITSRTLKEFETLKTQYEKNLCNLREQLKTARMKLADKYPQGDNTSENIDWLKHSLRDSNTENSIPSPLTFACKEIRKLVADIKPVSVEKQLALNWKKDIERPSFHHNQQLFNYCQLTDILSKKC

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.08
2	0.1
3	0.09
4	0.1
5	0.1
6	0.1
7	0.1
8	0.11
9	0.11
10	0.11
11	0.12
12	0.14
13	0.15
14	0.14
15	0.15
16	0.15
17	0.14
18	0.12
19	0.1
20	0.08
21	0.08
22	0.09
23	0.08
24	0.1
25	0.15
26	0.15
27	0.15
28	0.19
29	0.19
30	0.23
31	0.26
32	0.29
33	0.32
34	0.4
35	0.46
36	0.5
37	0.56
38	0.52
39	0.56
40	0.59
41	0.59
42	0.61
43	0.6
44	0.6
45	0.57
46	0.62
47	0.57
48	0.56
49	0.52
50	0.43
51	0.44
52	0.39
53	0.37
54	0.35
55	0.36
56	0.36
57	0.4
58	0.42
59	0.38
60	0.39
61	0.43
62	0.46
63	0.52
64	0.55
65	0.59
66	0.63
67	0.72
68	0.77
69	0.76
70	0.76
71	0.73
72	0.74
73	0.69
74	0.65
75	0.59
76	0.53
77	0.49
78	0.43
79	0.37
80	0.26
81	0.26
82	0.3
83	0.34
84	0.39
85	0.47
86	0.55
87	0.65
88	0.75
89	0.81
90	0.82
91	0.82
92	0.85
93	0.86
94	0.87
95	0.79
96	0.72
97	0.7
98	0.64
99	0.67
100	0.6
101	0.53
102	0.43
103	0.41
104	0.42
105	0.34
106	0.31
107	0.23
108	0.23
109	0.24
110	0.25
111	0.27
112	0.25
113	0.26
114	0.26
115	0.25
116	0.22
117	0.21
118	0.22
119	0.22
120	0.2
121	0.22
122	0.23
123	0.24
124	0.24
125	0.23
126	0.2
127	0.18
128	0.17
129	0.13
130	0.12
131	0.11
132	0.13
133	0.11
134	0.1
135	0.11
136	0.1
137	0.1
138	0.11
139	0.13
140	0.1
141	0.11
142	0.11
143	0.11
144	0.1
145	0.12
146	0.12
147	0.1
148	0.09
149	0.11
150	0.11
151	0.11
152	0.12
153	0.11
154	0.1
155	0.11
156	0.12
157	0.11
158	0.11
159	0.12
160	0.12
161	0.12
162	0.11
163	0.11
164	0.09
165	0.1
166	0.1
167	0.09
168	0.08
169	0.07
170	0.08
171	0.08
172	0.1
173	0.09
174	0.09
175	0.1
176	0.13
177	0.15
178	0.18
179	0.17
180	0.18
181	0.22
182	0.3
183	0.36
184	0.41
185	0.44
186	0.48
187	0.54
188	0.55
189	0.6
190	0.56
191	0.57
192	0.56
193	0.54
194	0.5
195	0.51
196	0.49
197	0.46
198	0.5
199	0.46
200	0.42
201	0.42
202	0.44
203	0.42
204	0.41
205	0.37
206	0.35
207	0.34
208	0.3
209	0.28
210	0.23
211	0.19
212	0.22
213	0.19
214	0.13
215	0.15
216	0.18
217	0.26
218	0.33
219	0.34
220	0.33
221	0.42
222	0.43
223	0.42
224	0.41
225	0.36
226	0.34
227	0.36
228	0.35
229	0.26
230	0.27
231	0.27
232	0.28
233	0.28
234	0.23
235	0.25
236	0.24
237	0.26
238	0.32
239	0.37
240	0.45
241	0.5
242	0.57
243	0.62
244	0.71
245	0.79
246	0.76
247	0.71
248	0.71
249	0.73
250	0.76
251	0.74
252	0.73
253	0.67
254	0.64
255	0.69
256	0.65
257	0.63
258	0.56
259	0.53
260	0.47
261	0.5
262	0.51
263	0.5
264	0.53
265	0.52
266	0.56
267	0.6
268	0.63
269	0.66
270	0.74
271	0.77
272	0.77
273	0.8
274	0.83
275	0.83
276	0.82
277	0.79
278	0.75
279	0.68
280	0.63
281	0.56
282	0.52
283	0.45
284	0.45
285	0.43
286	0.44
287	0.46
288	0.46
289	0.46
290	0.43
291	0.45
292	0.42
293	0.44
294	0.43
295	0.42
296	0.42
297	0.4
298	0.38
299	0.34
300	0.33
301	0.27
302	0.21
303	0.15
304	0.12
305	0.1
306	0.08
307	0.08
308	0.07
309	0.07
310	0.07
311	0.07
312	0.05
313	0.07
314	0.07
315	0.08
316	0.12
317	0.12
318	0.13
319	0.14
320	0.16
321	0.14
322	0.14
323	0.14
324	0.11
325	0.1
326	0.09
327	0.08
328	0.08
329	0.09
330	0.11
331	0.12
332	0.17
333	0.19
334	0.21
335	0.24
336	0.28
337	0.3
338	0.3
339	0.32
340	0.3
341	0.33
342	0.31
343	0.34
344	0.31
345	0.28
346	0.27
347	0.25
348	0.21
349	0.18
350	0.18
351	0.13
352	0.11
353	0.1
354	0.11
355	0.1
356	0.09
357	0.07
358	0.07
359	0.07
360	0.07
361	0.1
362	0.08
363	0.1
364	0.1
365	0.1
366	0.1
367	0.11
368	0.13
369	0.1
370	0.11
371	0.1
372	0.12
373	0.12
374	0.12
375	0.12
376	0.11
377	0.13
378	0.14
379	0.18
380	0.17
381	0.16
382	0.17
383	0.18
384	0.16
385	0.16
386	0.16
387	0.11
388	0.15
389	0.19
390	0.21
391	0.25
392	0.28
393	0.28
394	0.28
395	0.29
396	0.28
397	0.28
398	0.33
399	0.29
400	0.26
401	0.24
402	0.23
403	0.21
404	0.19
405	0.18
406	0.11
407	0.11
408	0.1
409	0.11
410	0.13
411	0.15
412	0.18
413	0.16
414	0.16
415	0.15
416	0.16
417	0.16
418	0.14
419	0.13
420	0.11
421	0.09
422	0.08
423	0.08
424	0.06
425	0.07
426	0.08
427	0.06
428	0.07
429	0.09
430	0.11
431	0.13
432	0.15
433	0.15
434	0.17
435	0.2
436	0.21
437	0.2
438	0.21
439	0.21
440	0.22
441	0.24
442	0.24
443	0.22
444	0.2
445	0.19
446	0.17
447	0.16
448	0.14
449	0.12
450	0.12
451	0.12
452	0.12
453	0.12
454	0.11
455	0.11
456	0.11
457	0.1
458	0.16
459	0.17
460	0.2
461	0.22
462	0.22
463	0.21
464	0.22
465	0.24
466	0.23
467	0.26
468	0.24
469	0.23
470	0.24
471	0.24
472	0.23
473	0.21
474	0.16
475	0.13
476	0.11
477	0.12
478	0.12
479	0.11
480	0.11
481	0.11
482	0.13
483	0.12
484	0.13
485	0.11
486	0.12
487	0.12
488	0.12
489	0.14
490	0.12
491	0.13
492	0.13
493	0.13
494	0.12
495	0.15
496	0.16
497	0.22
498	0.26
499	0.27
500	0.31
501	0.36
502	0.36
503	0.38
504	0.38
505	0.34
506	0.32
507	0.28
508	0.24
509	0.19
510	0.18
511	0.14
512	0.17
513	0.21
514	0.2
515	0.26
516	0.28
517	0.29
518	0.3
519	0.3
520	0.28
521	0.23
522	0.26
523	0.24
524	0.25
525	0.3
526	0.33
527	0.31
528	0.29
529	0.28
530	0.23
531	0.19
532	0.18
533	0.14
534	0.11
535	0.13
536	0.13
537	0.15
538	0.16
539	0.16
540	0.19
541	0.22
542	0.22
543	0.3
544	0.3
545	0.31
546	0.35
547	0.35
548	0.38
549	0.42
550	0.42
551	0.41
552	0.48
553	0.45
554	0.46
555	0.52
556	0.51
557	0.49
558	0.5
559	0.49
560	0.49
561	0.54
562	0.51
563	0.51
564	0.49
565	0.47
566	0.49
567	0.51
568	0.51
569	0.49
570	0.49
571	0.47
572	0.49
573	0.49
574	0.45
575	0.38
576	0.32
577	0.34
578	0.3
579	0.27
580	0.22
581	0.2
582	0.2
583	0.21
584	0.22
585	0.2
586	0.22
587	0.28
588	0.3
589	0.36
590	0.4
591	0.42
592	0.43
593	0.41
594	0.39
595	0.34
596	0.34
597	0.27
598	0.23
599	0.2
600	0.16
601	0.2
602	0.2
603	0.21
604	0.26
605	0.32
606	0.35
607	0.37
608	0.41
609	0.39
610	0.42
611	0.48
612	0.47
613	0.47
614	0.46
615	0.43
616	0.42
617	0.4
618	0.39
619	0.34
620	0.29
621	0.23
622	0.26
623	0.27
624	0.33
625	0.36
626	0.38
627	0.37
628	0.41
629	0.43
630	0.44
631	0.49
632	0.47
633	0.51
634	0.52
635	0.58
636	0.62
637	0.62
638	0.66
639	0.61
640	0.59
641	0.59
642	0.61
643	0.55
644	0.5
645	0.49
646	0.39
647	0.38
648	0.32
649	0.28
650	0.26

O42667

3D AlphaFold-predicted Structure Viewer