Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2A286

Protein Details
Accession A0A0D2A286    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-45TQSRSEQRRKYRFEKGKRPGDKBasic
NLS Segment(s)
PositionSequence
38-40KGK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MEQYQHYIPQLLLRNFSHPYQVPTQSRSEQRRKYRFEKGKRPGDKVLNVVDLHVRGRISGKVFIPPGPLPEVATAVICDYSPSSSATV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.35
4 0.34
5 0.27
6 0.3
7 0.31
8 0.38
9 0.37
10 0.38
11 0.42
12 0.42
13 0.49
14 0.53
15 0.57
16 0.58
17 0.66
18 0.72
19 0.74
20 0.75
21 0.77
22 0.78
23 0.78
24 0.8
25 0.79
26 0.8
27 0.78
28 0.77
29 0.72
30 0.67
31 0.6
32 0.51
33 0.44
34 0.37
35 0.31
36 0.27
37 0.22
38 0.17
39 0.15
40 0.14
41 0.11
42 0.08
43 0.1
44 0.12
45 0.14
46 0.17
47 0.17
48 0.2
49 0.22
50 0.22
51 0.25
52 0.23
53 0.23
54 0.22
55 0.22
56 0.18
57 0.18
58 0.19
59 0.15
60 0.15
61 0.12
62 0.1
63 0.1
64 0.09
65 0.09
66 0.08
67 0.09
68 0.1