Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9HEQ9

Protein Details
Accession Q9HEQ9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-149QEQPIKDRKKSKNKNGEEPETHydrophilic
NLS Segment(s)
PositionSequence
191-200GKGGSGKNKA
Subcellular Location(s) nucl 22.5, cyto_nucl 16.333, mito_nucl 12.498
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0140445  C:chromosome, telomeric repeat region  
GO:0005829  C:cytosol  
GO:0016607  C:nuclear speck  
GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0043047  F:single-stranded telomeric DNA binding  
GO:0051321  P:meiotic cell cycle  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0000723  P:telomere maintenance  
KEGG spo:SPBC660.11  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd00590  RRM_SF  
Amino Acid Sequences MMSAEETVTQNAPNTVQDQVEASVDAAVHASAEQSNTPAQQADDFRVFVGRLSTSTKKSEIRSLFETVGTVRKVTIPFRRVRRGTRLVPSGIAFVTFNNQEDVDKAIETLNGKTLDDREIVVQKARPVQEQPIKDRKKSKNKNGEEPETSTSVENAESAKGSSDENEANTATAPSSNEANGVDKKQNEIKGKGGSGKNKAKPLPPNSIYVSGLSVTLTNEGLKEMFDAYNPTRARIAVRSLPPYIIRRIKLRGEQRRGRGFGFVSFANAEDQSRAIEEMNGKQVGDLTLVVKSAVFREDKQNDENEKNENEPIEASESAPTNVSDSTEPKASEVDSEEKSGVTASAITA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.16
5 0.16
6 0.16
7 0.16
8 0.14
9 0.13
10 0.11
11 0.11
12 0.1
13 0.09
14 0.07
15 0.06
16 0.06
17 0.07
18 0.06
19 0.08
20 0.08
21 0.1
22 0.12
23 0.13
24 0.14
25 0.14
26 0.13
27 0.17
28 0.2
29 0.23
30 0.23
31 0.23
32 0.22
33 0.23
34 0.22
35 0.18
36 0.18
37 0.14
38 0.13
39 0.19
40 0.24
41 0.26
42 0.3
43 0.34
44 0.37
45 0.39
46 0.47
47 0.45
48 0.45
49 0.46
50 0.46
51 0.42
52 0.38
53 0.35
54 0.27
55 0.28
56 0.23
57 0.19
58 0.15
59 0.18
60 0.2
61 0.26
62 0.33
63 0.34
64 0.41
65 0.5
66 0.59
67 0.61
68 0.65
69 0.69
70 0.68
71 0.68
72 0.69
73 0.66
74 0.57
75 0.54
76 0.47
77 0.39
78 0.31
79 0.24
80 0.16
81 0.11
82 0.13
83 0.12
84 0.12
85 0.11
86 0.12
87 0.11
88 0.12
89 0.14
90 0.11
91 0.1
92 0.1
93 0.09
94 0.11
95 0.12
96 0.12
97 0.14
98 0.14
99 0.14
100 0.15
101 0.15
102 0.16
103 0.15
104 0.15
105 0.13
106 0.16
107 0.17
108 0.18
109 0.18
110 0.19
111 0.24
112 0.24
113 0.24
114 0.23
115 0.3
116 0.35
117 0.38
118 0.43
119 0.48
120 0.51
121 0.54
122 0.62
123 0.64
124 0.69
125 0.75
126 0.77
127 0.78
128 0.8
129 0.85
130 0.83
131 0.79
132 0.71
133 0.64
134 0.56
135 0.46
136 0.41
137 0.3
138 0.23
139 0.17
140 0.13
141 0.1
142 0.08
143 0.07
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.07
150 0.09
151 0.09
152 0.09
153 0.1
154 0.1
155 0.09
156 0.09
157 0.09
158 0.06
159 0.06
160 0.06
161 0.06
162 0.07
163 0.06
164 0.07
165 0.07
166 0.1
167 0.11
168 0.13
169 0.15
170 0.14
171 0.17
172 0.21
173 0.26
174 0.28
175 0.28
176 0.3
177 0.3
178 0.31
179 0.35
180 0.35
181 0.34
182 0.39
183 0.46
184 0.46
185 0.49
186 0.51
187 0.49
188 0.53
189 0.54
190 0.55
191 0.48
192 0.48
193 0.44
194 0.45
195 0.4
196 0.32
197 0.27
198 0.17
199 0.16
200 0.12
201 0.09
202 0.07
203 0.07
204 0.07
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.06
211 0.07
212 0.07
213 0.07
214 0.11
215 0.12
216 0.2
217 0.2
218 0.2
219 0.2
220 0.2
221 0.22
222 0.21
223 0.25
224 0.24
225 0.28
226 0.31
227 0.31
228 0.32
229 0.34
230 0.34
231 0.37
232 0.36
233 0.34
234 0.35
235 0.4
236 0.44
237 0.48
238 0.56
239 0.58
240 0.62
241 0.68
242 0.72
243 0.75
244 0.72
245 0.65
246 0.58
247 0.48
248 0.41
249 0.36
250 0.27
251 0.2
252 0.18
253 0.18
254 0.15
255 0.15
256 0.13
257 0.11
258 0.11
259 0.09
260 0.1
261 0.1
262 0.09
263 0.11
264 0.13
265 0.16
266 0.21
267 0.21
268 0.2
269 0.2
270 0.21
271 0.18
272 0.17
273 0.14
274 0.09
275 0.1
276 0.1
277 0.1
278 0.09
279 0.09
280 0.09
281 0.12
282 0.14
283 0.15
284 0.25
285 0.3
286 0.34
287 0.37
288 0.44
289 0.47
290 0.49
291 0.49
292 0.45
293 0.43
294 0.41
295 0.4
296 0.33
297 0.27
298 0.23
299 0.23
300 0.21
301 0.19
302 0.17
303 0.18
304 0.18
305 0.18
306 0.18
307 0.16
308 0.14
309 0.14
310 0.15
311 0.15
312 0.16
313 0.19
314 0.23
315 0.23
316 0.22
317 0.23
318 0.21
319 0.21
320 0.24
321 0.26
322 0.23
323 0.26
324 0.25
325 0.24
326 0.23
327 0.21
328 0.16
329 0.11