Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZR90

Protein Details
Accession A0A0D1ZR90    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
469-494FPVKSPPPRYAKPPCPPPPPKNTPYSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 23, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002293  AA/rel_permease1  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF13520  AA_permease_2  
Amino Acid Sequences MPELKEKKSTDGPEEALATGGQEIAITLDGEIVNASGHIDQLNRQYGLLSICGLALTVDNAWVALGTSLAVSIYNGGAPGVIWELWVAAFYYSFINASIAEFASSVPSSGGVYHWATITAGPKWGRPVGFFAGSLNYFGWLFDLASIAYIMSELCVQMYFLYHPDYVIQPWNLFVGLLCIIVLCLAVTIFFNGALAYLQHFGLFIVTVGGIITIIVLASMPSQHASTSFVWTDFENNTGWSGGVAFLTGVLNGAFTIGTPDAVTHMAEELPNPKRDLPKAIFAQIGLGFLYAWCFAIALFYGVNDLTAVQNSNGSFPLAQAYSQATGSRAATFGLLFIIFLSLVPCLIGTFLTVGRTWWALARDNATPFSGFFSHVNERLSCPVEATLLTGVLTIGLCAITLGSKTAFNDLAGSFVVLSSVSYAVTILPNIITRRKYMPVGPFHLGMAGYIINGLAVLFIILFDIFFCFPVKSPPPRYAKPPCPPPPPKNTPYSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.32
4 0.26
5 0.2
6 0.14
7 0.11
8 0.08
9 0.06
10 0.05
11 0.05
12 0.06
13 0.06
14 0.05
15 0.08
16 0.08
17 0.08
18 0.08
19 0.07
20 0.06
21 0.06
22 0.07
23 0.05
24 0.06
25 0.08
26 0.09
27 0.12
28 0.19
29 0.25
30 0.24
31 0.24
32 0.23
33 0.25
34 0.25
35 0.23
36 0.17
37 0.11
38 0.11
39 0.11
40 0.1
41 0.08
42 0.06
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.06
75 0.05
76 0.05
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.08
85 0.09
86 0.08
87 0.08
88 0.08
89 0.08
90 0.1
91 0.09
92 0.09
93 0.08
94 0.08
95 0.08
96 0.08
97 0.09
98 0.09
99 0.1
100 0.11
101 0.11
102 0.11
103 0.11
104 0.12
105 0.15
106 0.12
107 0.17
108 0.17
109 0.18
110 0.21
111 0.25
112 0.24
113 0.22
114 0.26
115 0.25
116 0.26
117 0.24
118 0.21
119 0.21
120 0.2
121 0.2
122 0.15
123 0.12
124 0.1
125 0.1
126 0.1
127 0.07
128 0.07
129 0.06
130 0.06
131 0.05
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.06
146 0.06
147 0.07
148 0.1
149 0.1
150 0.1
151 0.11
152 0.12
153 0.13
154 0.16
155 0.16
156 0.13
157 0.13
158 0.14
159 0.12
160 0.11
161 0.09
162 0.07
163 0.07
164 0.06
165 0.06
166 0.05
167 0.05
168 0.05
169 0.05
170 0.03
171 0.02
172 0.02
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.03
180 0.04
181 0.04
182 0.04
183 0.05
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.05
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.03
207 0.03
208 0.04
209 0.04
210 0.04
211 0.05
212 0.09
213 0.1
214 0.12
215 0.12
216 0.12
217 0.13
218 0.13
219 0.15
220 0.11
221 0.11
222 0.09
223 0.09
224 0.09
225 0.08
226 0.08
227 0.06
228 0.06
229 0.05
230 0.04
231 0.04
232 0.03
233 0.04
234 0.04
235 0.04
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.04
244 0.04
245 0.04
246 0.04
247 0.05
248 0.06
249 0.06
250 0.06
251 0.05
252 0.05
253 0.05
254 0.06
255 0.06
256 0.11
257 0.14
258 0.16
259 0.17
260 0.19
261 0.22
262 0.24
263 0.31
264 0.27
265 0.31
266 0.32
267 0.33
268 0.3
269 0.27
270 0.27
271 0.2
272 0.18
273 0.11
274 0.09
275 0.06
276 0.06
277 0.07
278 0.05
279 0.05
280 0.04
281 0.04
282 0.04
283 0.04
284 0.05
285 0.05
286 0.04
287 0.04
288 0.05
289 0.05
290 0.05
291 0.04
292 0.05
293 0.04
294 0.05
295 0.06
296 0.05
297 0.08
298 0.08
299 0.09
300 0.09
301 0.09
302 0.09
303 0.08
304 0.1
305 0.09
306 0.08
307 0.09
308 0.1
309 0.1
310 0.11
311 0.11
312 0.1
313 0.11
314 0.12
315 0.11
316 0.1
317 0.09
318 0.09
319 0.08
320 0.08
321 0.07
322 0.06
323 0.05
324 0.05
325 0.05
326 0.04
327 0.04
328 0.05
329 0.04
330 0.04
331 0.04
332 0.04
333 0.03
334 0.04
335 0.04
336 0.04
337 0.05
338 0.06
339 0.07
340 0.07
341 0.08
342 0.09
343 0.09
344 0.09
345 0.11
346 0.13
347 0.15
348 0.17
349 0.19
350 0.21
351 0.23
352 0.24
353 0.22
354 0.2
355 0.17
356 0.19
357 0.17
358 0.15
359 0.14
360 0.19
361 0.22
362 0.25
363 0.27
364 0.24
365 0.26
366 0.28
367 0.3
368 0.24
369 0.2
370 0.18
371 0.17
372 0.16
373 0.15
374 0.12
375 0.09
376 0.09
377 0.08
378 0.07
379 0.07
380 0.06
381 0.05
382 0.04
383 0.04
384 0.04
385 0.03
386 0.04
387 0.04
388 0.04
389 0.06
390 0.06
391 0.08
392 0.09
393 0.12
394 0.13
395 0.12
396 0.15
397 0.14
398 0.14
399 0.13
400 0.12
401 0.09
402 0.08
403 0.08
404 0.06
405 0.06
406 0.05
407 0.06
408 0.05
409 0.05
410 0.06
411 0.07
412 0.07
413 0.08
414 0.07
415 0.08
416 0.11
417 0.15
418 0.2
419 0.21
420 0.24
421 0.28
422 0.32
423 0.35
424 0.38
425 0.43
426 0.46
427 0.51
428 0.5
429 0.46
430 0.42
431 0.4
432 0.33
433 0.25
434 0.18
435 0.12
436 0.08
437 0.07
438 0.07
439 0.05
440 0.05
441 0.05
442 0.03
443 0.03
444 0.03
445 0.03
446 0.03
447 0.04
448 0.04
449 0.04
450 0.04
451 0.06
452 0.07
453 0.08
454 0.1
455 0.1
456 0.11
457 0.2
458 0.27
459 0.34
460 0.4
461 0.49
462 0.56
463 0.6
464 0.69
465 0.71
466 0.74
467 0.75
468 0.8
469 0.8
470 0.82
471 0.88
472 0.87
473 0.87
474 0.86
475 0.82