Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1ZBJ6

Protein Details
Accession A0A0D1ZBJ6    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
6-31ADQYRDLRSRRHARNRHAKHASKYYGHydrophilic
100-120DRQHHRGKKIREKRHTKWTLEBasic
NLS Segment(s)
PositionSequence
104-114HRGKKIREKRH
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MDPDYADQYRDLRSRRHARNRHAKHASKYYGYRGVHPSWVGQPHYSFMLHPSTRRSLPGEYSSFYQASAPLVSMPQHMKISTWTKRDMWLDRDTDIWPLDRQHHRGKKIREKRHTKWTLETLGRRMKAQSKTMNGTIAEGRAEVAMLCHDQGWNRGHEHPDSDPSNSDSEVDDNGSMVQDIADEDREQADHDGSGDEEGFEFVSADDFDVQSLSSMGEFDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.71
4 0.74
5 0.79
6 0.86
7 0.89
8 0.89
9 0.89
10 0.86
11 0.84
12 0.84
13 0.79
14 0.75
15 0.7
16 0.66
17 0.64
18 0.57
19 0.54
20 0.5
21 0.46
22 0.43
23 0.4
24 0.36
25 0.33
26 0.37
27 0.33
28 0.3
29 0.28
30 0.26
31 0.27
32 0.25
33 0.19
34 0.17
35 0.23
36 0.23
37 0.24
38 0.27
39 0.3
40 0.31
41 0.33
42 0.34
43 0.28
44 0.31
45 0.36
46 0.33
47 0.3
48 0.31
49 0.31
50 0.28
51 0.25
52 0.21
53 0.15
54 0.13
55 0.12
56 0.1
57 0.07
58 0.08
59 0.08
60 0.11
61 0.12
62 0.13
63 0.14
64 0.14
65 0.14
66 0.18
67 0.26
68 0.3
69 0.32
70 0.32
71 0.32
72 0.36
73 0.41
74 0.4
75 0.36
76 0.35
77 0.33
78 0.31
79 0.31
80 0.27
81 0.24
82 0.2
83 0.17
84 0.13
85 0.13
86 0.19
87 0.22
88 0.26
89 0.34
90 0.4
91 0.46
92 0.53
93 0.6
94 0.64
95 0.71
96 0.76
97 0.76
98 0.8
99 0.78
100 0.82
101 0.81
102 0.72
103 0.67
104 0.62
105 0.58
106 0.53
107 0.5
108 0.45
109 0.43
110 0.41
111 0.37
112 0.34
113 0.35
114 0.34
115 0.39
116 0.38
117 0.37
118 0.4
119 0.41
120 0.41
121 0.33
122 0.31
123 0.25
124 0.19
125 0.15
126 0.11
127 0.1
128 0.07
129 0.07
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.07
138 0.12
139 0.14
140 0.16
141 0.18
142 0.21
143 0.24
144 0.24
145 0.27
146 0.24
147 0.28
148 0.28
149 0.27
150 0.25
151 0.25
152 0.25
153 0.22
154 0.21
155 0.15
156 0.14
157 0.14
158 0.13
159 0.11
160 0.1
161 0.1
162 0.09
163 0.08
164 0.07
165 0.05
166 0.04
167 0.05
168 0.06
169 0.08
170 0.08
171 0.09
172 0.09
173 0.1
174 0.11
175 0.12
176 0.11
177 0.1
178 0.1
179 0.1
180 0.1
181 0.11
182 0.1
183 0.08
184 0.08
185 0.08
186 0.08
187 0.07
188 0.07
189 0.06
190 0.07
191 0.07
192 0.08
193 0.09
194 0.09
195 0.09
196 0.09
197 0.09
198 0.08
199 0.08
200 0.07
201 0.06