Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9UT56

Protein Details
Accession Q9UT56    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTQKRRNCGRNKHGRGHTKFVRCBasic
88-111SREGRRIRTPPPRVRYNRDGKRVNBasic
NLS Segment(s)
PositionSequence
87-108RSREGRRIRTPPPRVRYNRDGK
Subcellular Location(s) mito 17, cyto 7.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003729  F:mRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042254  P:ribosome biogenesis  
KEGG spo:SPAC806.03c  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTQKRRNCGRNKHGRGHTKFVRCINCSRAVPKDKAIKRWNIRNMVETAAIRDLSEASVYSEYAIPKIYVKLQYCVSCAIHARVVRVRSREGRRIRTPPPRVRYNRDGKRVNPAAIAKTAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.84
4 0.81
5 0.78
6 0.76
7 0.73
8 0.71
9 0.64
10 0.62
11 0.58
12 0.57
13 0.51
14 0.49
15 0.51
16 0.49
17 0.49
18 0.5
19 0.55
20 0.51
21 0.58
22 0.6
23 0.61
24 0.63
25 0.69
26 0.7
27 0.68
28 0.65
29 0.59
30 0.55
31 0.46
32 0.41
33 0.31
34 0.25
35 0.18
36 0.16
37 0.13
38 0.11
39 0.09
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.09
54 0.11
55 0.15
56 0.17
57 0.19
58 0.22
59 0.23
60 0.23
61 0.25
62 0.23
63 0.19
64 0.19
65 0.18
66 0.19
67 0.19
68 0.21
69 0.22
70 0.26
71 0.28
72 0.29
73 0.34
74 0.38
75 0.45
76 0.51
77 0.56
78 0.61
79 0.65
80 0.69
81 0.73
82 0.75
83 0.78
84 0.78
85 0.78
86 0.79
87 0.79
88 0.8
89 0.81
90 0.82
91 0.81
92 0.81
93 0.8
94 0.72
95 0.75
96 0.72
97 0.64
98 0.59
99 0.53
100 0.47