Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2BV49

Protein Details
Accession A0A0D2BV49    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-62KDEPPIFLRLYRRRNTKRRLCIALVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 4, pero 4, nucl 2, golg 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001087  GDSL  
IPR036514  SGNH_hydro_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0016788  F:hydrolase activity, acting on ester bonds  
Pfam View protein in Pfam  
PF00657  Lipase_GDSL  
CDD cd01846  fatty_acyltransferase_like  
Amino Acid Sequences MADPKSYSDDHSSHADDDADIGLTPLSHKPTEEPLLTKDEPPIFLRLYRRRNTKRRLCIALVLVTTLFCVALVGIGGVPDSVPRPNLKMLEKPRWNVKNFKSLITFGDSYTDEGRYHYWYQHNKTYPPVGTFFPSSKQTRNWARYTIQYTGSSNGEEWKPQMTLYDYAFGGSWCSDEIIPRGPKKASVLEGGVPAFLNDLTAARAGTEEPYFQPSITASNAVFVIWIGTNDLGNFAYLSNEQTPGKFLADFNECVFRSVDKLYAAGARTFVLMNTVPLQLTPLYSIKLPSGEEKVRDRWMAPKAIEITKVVNDIYRYQTPYEFAVSNRYPDARVALFDVNSLMTDMYFSPEFYFNGTAPANVTSFYTKTQEDRLNPDSFMWRDDLHPSEQTHRNIAAELVRVLDGTSDYAQYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.21
4 0.21
5 0.18
6 0.13
7 0.1
8 0.09
9 0.08
10 0.07
11 0.1
12 0.12
13 0.16
14 0.16
15 0.17
16 0.2
17 0.27
18 0.33
19 0.34
20 0.34
21 0.33
22 0.4
23 0.41
24 0.4
25 0.39
26 0.36
27 0.35
28 0.34
29 0.35
30 0.28
31 0.32
32 0.4
33 0.44
34 0.5
35 0.56
36 0.65
37 0.72
38 0.8
39 0.86
40 0.87
41 0.88
42 0.87
43 0.87
44 0.79
45 0.74
46 0.68
47 0.63
48 0.52
49 0.42
50 0.33
51 0.25
52 0.22
53 0.15
54 0.11
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.06
68 0.07
69 0.09
70 0.11
71 0.14
72 0.19
73 0.24
74 0.27
75 0.35
76 0.42
77 0.51
78 0.56
79 0.57
80 0.63
81 0.66
82 0.66
83 0.66
84 0.63
85 0.63
86 0.58
87 0.58
88 0.51
89 0.45
90 0.43
91 0.39
92 0.35
93 0.25
94 0.26
95 0.23
96 0.21
97 0.21
98 0.21
99 0.15
100 0.15
101 0.16
102 0.18
103 0.19
104 0.22
105 0.29
106 0.35
107 0.41
108 0.48
109 0.52
110 0.48
111 0.51
112 0.52
113 0.46
114 0.4
115 0.37
116 0.3
117 0.28
118 0.29
119 0.26
120 0.23
121 0.27
122 0.27
123 0.29
124 0.3
125 0.36
126 0.44
127 0.49
128 0.49
129 0.47
130 0.46
131 0.49
132 0.51
133 0.45
134 0.39
135 0.35
136 0.33
137 0.3
138 0.29
139 0.23
140 0.18
141 0.18
142 0.15
143 0.14
144 0.14
145 0.13
146 0.13
147 0.12
148 0.13
149 0.12
150 0.14
151 0.14
152 0.16
153 0.14
154 0.14
155 0.14
156 0.13
157 0.11
158 0.08
159 0.07
160 0.05
161 0.06
162 0.06
163 0.06
164 0.08
165 0.14
166 0.18
167 0.19
168 0.22
169 0.21
170 0.23
171 0.25
172 0.26
173 0.22
174 0.2
175 0.2
176 0.18
177 0.2
178 0.18
179 0.16
180 0.12
181 0.1
182 0.08
183 0.06
184 0.05
185 0.03
186 0.04
187 0.04
188 0.05
189 0.04
190 0.04
191 0.05
192 0.05
193 0.06
194 0.06
195 0.06
196 0.07
197 0.1
198 0.1
199 0.1
200 0.1
201 0.09
202 0.1
203 0.1
204 0.11
205 0.08
206 0.09
207 0.09
208 0.08
209 0.08
210 0.06
211 0.06
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.08
226 0.08
227 0.1
228 0.11
229 0.11
230 0.12
231 0.13
232 0.13
233 0.12
234 0.11
235 0.13
236 0.16
237 0.17
238 0.16
239 0.21
240 0.2
241 0.21
242 0.22
243 0.18
244 0.17
245 0.17
246 0.18
247 0.12
248 0.12
249 0.11
250 0.14
251 0.15
252 0.13
253 0.12
254 0.1
255 0.11
256 0.11
257 0.1
258 0.09
259 0.08
260 0.09
261 0.1
262 0.11
263 0.1
264 0.09
265 0.11
266 0.09
267 0.09
268 0.11
269 0.1
270 0.1
271 0.11
272 0.12
273 0.11
274 0.13
275 0.13
276 0.14
277 0.19
278 0.21
279 0.25
280 0.29
281 0.32
282 0.34
283 0.35
284 0.33
285 0.33
286 0.35
287 0.37
288 0.33
289 0.34
290 0.35
291 0.36
292 0.36
293 0.31
294 0.28
295 0.24
296 0.25
297 0.19
298 0.17
299 0.16
300 0.18
301 0.23
302 0.24
303 0.25
304 0.25
305 0.26
306 0.26
307 0.26
308 0.26
309 0.22
310 0.18
311 0.25
312 0.24
313 0.25
314 0.26
315 0.25
316 0.23
317 0.22
318 0.26
319 0.18
320 0.18
321 0.19
322 0.2
323 0.19
324 0.18
325 0.18
326 0.14
327 0.13
328 0.13
329 0.09
330 0.06
331 0.07
332 0.07
333 0.1
334 0.1
335 0.1
336 0.12
337 0.14
338 0.15
339 0.17
340 0.19
341 0.15
342 0.2
343 0.19
344 0.17
345 0.17
346 0.18
347 0.16
348 0.14
349 0.15
350 0.14
351 0.15
352 0.17
353 0.2
354 0.2
355 0.22
356 0.3
357 0.35
358 0.37
359 0.43
360 0.46
361 0.45
362 0.44
363 0.44
364 0.43
365 0.37
366 0.34
367 0.29
368 0.25
369 0.24
370 0.29
371 0.31
372 0.27
373 0.31
374 0.32
375 0.37
376 0.44
377 0.45
378 0.45
379 0.43
380 0.4
381 0.36
382 0.35
383 0.31
384 0.26
385 0.23
386 0.2
387 0.18
388 0.17
389 0.16
390 0.15
391 0.12
392 0.12
393 0.13