Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BJK5

Protein Details
Accession A0A0D2BJK5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-127DLRPKQTRAIRRRLSKKDASRITEKQKKKQIHFPQRKYAIKAEHydrophilic
NLS Segment(s)
PositionSequence
87-119RPKQTRAIRRRLSKKDASRITEKQKKKQIHFPQ
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTNARVKPGQLWNKGRDDLKKQLDELKTELGQLRVQKIAGGASSKLTRIHDLRKSIARVLTVINANQRHQLRLFYQKKKYLPLDLRPKQTRAIRRRLSKKDASRITEKQKKKQIHFPQRKYAIKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.64
4 0.61
5 0.59
6 0.59
7 0.6
8 0.56
9 0.52
10 0.55
11 0.53
12 0.49
13 0.44
14 0.39
15 0.31
16 0.3
17 0.3
18 0.24
19 0.24
20 0.24
21 0.23
22 0.2
23 0.19
24 0.18
25 0.16
26 0.15
27 0.13
28 0.12
29 0.1
30 0.11
31 0.12
32 0.13
33 0.14
34 0.15
35 0.18
36 0.19
37 0.26
38 0.29
39 0.31
40 0.34
41 0.37
42 0.37
43 0.36
44 0.34
45 0.27
46 0.23
47 0.2
48 0.19
49 0.15
50 0.14
51 0.17
52 0.17
53 0.17
54 0.22
55 0.22
56 0.2
57 0.2
58 0.22
59 0.2
60 0.3
61 0.38
62 0.4
63 0.47
64 0.52
65 0.53
66 0.58
67 0.57
68 0.56
69 0.54
70 0.55
71 0.59
72 0.59
73 0.67
74 0.64
75 0.63
76 0.61
77 0.61
78 0.62
79 0.59
80 0.64
81 0.63
82 0.69
83 0.78
84 0.8
85 0.81
86 0.81
87 0.82
88 0.81
89 0.8
90 0.76
91 0.74
92 0.74
93 0.76
94 0.76
95 0.75
96 0.74
97 0.75
98 0.79
99 0.77
100 0.8
101 0.8
102 0.82
103 0.86
104 0.84
105 0.86
106 0.86
107 0.86
108 0.81