Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2TRL2

Protein Details
Accession G2TRL2    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSYPKARIRRFFRQHCQRSLESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0043505  C:CENP-A containing nucleosome  
GO:0061838  C:CENP-T-W-S-X complex  
GO:0000776  C:kinetochore  
GO:0005654  C:nucleoplasm  
GO:0046982  F:protein heterodimerization activity  
GO:0007059  P:chromosome segregation  
GO:0051382  P:kinetochore assembly  
GO:0000278  P:mitotic cell cycle  
GO:0000070  P:mitotic sister chromatid segregation  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSYPKARIRRFFRQHCQRSLESSALDLVYLDYCLFLQSLLKEANIEAAKTGERRVQPEHVRSIQRKILAQFKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.81
4 0.72
5 0.68
6 0.61
7 0.53
8 0.41
9 0.34
10 0.27
11 0.21
12 0.18
13 0.12
14 0.09
15 0.06
16 0.06
17 0.05
18 0.04
19 0.04
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.13
31 0.13
32 0.13
33 0.1
34 0.11
35 0.12
36 0.13
37 0.15
38 0.14
39 0.16
40 0.2
41 0.24
42 0.33
43 0.39
44 0.43
45 0.5
46 0.52
47 0.58
48 0.58
49 0.61
50 0.57
51 0.54
52 0.54
53 0.5