Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9Y7K8

Protein Details
Accession Q9Y7K8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
42-69HHCSRDLIRRDTKKLKKKPKHIAVIIECBasic
NLS Segment(s)
PositionSequence
52-61DTKKLKKKPK
Subcellular Location(s) cyto 14.5, cyto_nucl 11.5, nucl 7.5, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038887  Nus1/NgBR  
IPR036424  UPP_synth-like_sf  
Gene Ontology GO:1904423  C:dehydrodolichyl diphosphate synthase complex  
GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0019408  P:dolichol biosynthetic process  
GO:0006486  P:protein glycosylation  
KEGG spo:SPBC2A9.06c  -  
Amino Acid Sequences MYDDIFFYLALWVIQSVYGAWDWAKNWVFWTCSYLLNFLYHHHCSRDLIRRDTKKLKKKPKHIAVIIECVEDGGIEGLIHDACELSAWCVCSNIRELTIYERKGFLKQSPEAVEKAIYSHLPFYLGGDKCTVHVTNPCSPDEKNQNDCVDLKVHLIAKEDGRDAIIDLTRGLADLCTKKVISSTQVTLELIDKELKESVIPEPDLLIIFAPLLKLQGFPPWQLRLCEIFHDPILYTTNYLTFFKALVHYSNAEMRLGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.07
5 0.07
6 0.08
7 0.08
8 0.1
9 0.11
10 0.18
11 0.19
12 0.18
13 0.21
14 0.23
15 0.25
16 0.23
17 0.28
18 0.22
19 0.25
20 0.26
21 0.25
22 0.23
23 0.23
24 0.23
25 0.21
26 0.25
27 0.26
28 0.27
29 0.27
30 0.27
31 0.28
32 0.36
33 0.43
34 0.43
35 0.48
36 0.55
37 0.6
38 0.68
39 0.75
40 0.77
41 0.78
42 0.81
43 0.84
44 0.85
45 0.89
46 0.91
47 0.9
48 0.9
49 0.85
50 0.83
51 0.76
52 0.73
53 0.64
54 0.52
55 0.42
56 0.32
57 0.26
58 0.16
59 0.12
60 0.05
61 0.04
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.04
71 0.04
72 0.05
73 0.06
74 0.07
75 0.08
76 0.09
77 0.09
78 0.1
79 0.13
80 0.13
81 0.12
82 0.12
83 0.13
84 0.19
85 0.26
86 0.26
87 0.24
88 0.25
89 0.25
90 0.27
91 0.28
92 0.24
93 0.24
94 0.24
95 0.27
96 0.29
97 0.3
98 0.28
99 0.27
100 0.24
101 0.17
102 0.17
103 0.13
104 0.1
105 0.08
106 0.08
107 0.07
108 0.08
109 0.08
110 0.08
111 0.15
112 0.15
113 0.15
114 0.15
115 0.15
116 0.15
117 0.17
118 0.15
119 0.09
120 0.13
121 0.17
122 0.21
123 0.23
124 0.23
125 0.23
126 0.24
127 0.29
128 0.34
129 0.36
130 0.34
131 0.37
132 0.36
133 0.36
134 0.36
135 0.32
136 0.24
137 0.19
138 0.16
139 0.14
140 0.15
141 0.14
142 0.16
143 0.16
144 0.16
145 0.17
146 0.17
147 0.14
148 0.13
149 0.12
150 0.1
151 0.1
152 0.09
153 0.08
154 0.07
155 0.07
156 0.07
157 0.07
158 0.06
159 0.05
160 0.08
161 0.1
162 0.11
163 0.13
164 0.13
165 0.13
166 0.15
167 0.16
168 0.17
169 0.19
170 0.2
171 0.2
172 0.22
173 0.22
174 0.21
175 0.21
176 0.17
177 0.15
178 0.15
179 0.12
180 0.12
181 0.13
182 0.12
183 0.11
184 0.12
185 0.13
186 0.16
187 0.16
188 0.15
189 0.15
190 0.15
191 0.15
192 0.14
193 0.11
194 0.06
195 0.06
196 0.06
197 0.06
198 0.05
199 0.06
200 0.06
201 0.07
202 0.08
203 0.15
204 0.16
205 0.19
206 0.25
207 0.29
208 0.32
209 0.33
210 0.36
211 0.33
212 0.32
213 0.33
214 0.31
215 0.28
216 0.26
217 0.26
218 0.23
219 0.2
220 0.22
221 0.19
222 0.16
223 0.15
224 0.17
225 0.18
226 0.19
227 0.18
228 0.16
229 0.16
230 0.16
231 0.19
232 0.18
233 0.18
234 0.21
235 0.21
236 0.23
237 0.28
238 0.27