Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZCL9

Protein Details
Accession A0A0D1ZCL9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-101KYTIFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
82-94KEKRYRKGIHKLP
Subcellular Location(s) mito 21.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSALSGGLLWKIPWRLSSMQKARQRKRLKLVDKVVDTVSMALQNNGGMTAKAVDRWYQEMPREEEMLPKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.18
4 0.16
5 0.2
6 0.24
7 0.3
8 0.4
9 0.45
10 0.52
11 0.6
12 0.69
13 0.72
14 0.77
15 0.79
16 0.77
17 0.79
18 0.8
19 0.78
20 0.77
21 0.78
22 0.76
23 0.68
24 0.62
25 0.52
26 0.42
27 0.35
28 0.25
29 0.17
30 0.12
31 0.1
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.07
44 0.08
45 0.09
46 0.12
47 0.15
48 0.16
49 0.2
50 0.23
51 0.26
52 0.27
53 0.28
54 0.25
55 0.27
56 0.27
57 0.3
58 0.26
59 0.23
60 0.22
61 0.21
62 0.24
63 0.26
64 0.32
65 0.3
66 0.39
67 0.45
68 0.54
69 0.63
70 0.68
71 0.7
72 0.71
73 0.76
74 0.78
75 0.82
76 0.82
77 0.83
78 0.83
79 0.87
80 0.86
81 0.87
82 0.82
83 0.8
84 0.8
85 0.79
86 0.8
87 0.77
88 0.79