Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZB71

Protein Details
Accession A0A0D1ZB71    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-38PSQGKRKAATKPQGPKKREPBasic
NLS Segment(s)
PositionSequence
23-36KRKAATKPQGPKKR
Subcellular Location(s) cyto_nucl 13.333, nucl 12.5, cyto 12, mito_nucl 7.166, cyto_pero 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MSPSVPPARPLEAAQTDLPSQGKRKAATKPQGPKKREPLATTFTCLFCNHEKAIQIKLDKKAGVGNLHCKVCGQRFQTGINYLSAAVDVYSDWIDACENVAQEAAAQEAEDQKFSSYATARPGAGAAASRVDDEEEEDGDYGGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.26
4 0.27
5 0.28
6 0.22
7 0.23
8 0.26
9 0.3
10 0.3
11 0.35
12 0.41
13 0.5
14 0.56
15 0.62
16 0.67
17 0.73
18 0.8
19 0.8
20 0.8
21 0.79
22 0.79
23 0.75
24 0.68
25 0.63
26 0.6
27 0.57
28 0.51
29 0.44
30 0.36
31 0.32
32 0.28
33 0.26
34 0.22
35 0.24
36 0.21
37 0.21
38 0.23
39 0.23
40 0.26
41 0.26
42 0.27
43 0.28
44 0.3
45 0.31
46 0.29
47 0.27
48 0.26
49 0.25
50 0.25
51 0.22
52 0.25
53 0.27
54 0.27
55 0.26
56 0.24
57 0.24
58 0.23
59 0.27
60 0.23
61 0.22
62 0.23
63 0.25
64 0.28
65 0.28
66 0.26
67 0.2
68 0.18
69 0.14
70 0.12
71 0.1
72 0.08
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.06
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.04
93 0.04
94 0.05
95 0.1
96 0.1
97 0.11
98 0.11
99 0.11
100 0.12
101 0.12
102 0.15
103 0.12
104 0.14
105 0.18
106 0.2
107 0.19
108 0.19
109 0.2
110 0.16
111 0.15
112 0.14
113 0.1
114 0.1
115 0.11
116 0.11
117 0.11
118 0.12
119 0.11
120 0.12
121 0.13
122 0.12
123 0.12
124 0.12