Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2BNM0

Protein Details
Accession A0A0D2BNM0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-93KGKFQCKGLSNKKRERRKKENLCYNYRNPRYHydrophilic
NLS Segment(s)
PositionSequence
69-81KGLSNKKRERRKK
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MYQGLVNKAIEIDNWLYELGLKKKGYYGKTGGVYYKGKRTNYQFYGDSMDLDVIERGRSSRLKGKFQCKGLSNKKRERRKKENLCYNYRNPRYKANEYGTKPVRLHIIEVGIEEEKADTLIKKELKRLRLESKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.14
5 0.19
6 0.19
7 0.24
8 0.23
9 0.23
10 0.29
11 0.35
12 0.35
13 0.36
14 0.37
15 0.36
16 0.4
17 0.41
18 0.37
19 0.37
20 0.39
21 0.35
22 0.4
23 0.39
24 0.38
25 0.42
26 0.47
27 0.51
28 0.49
29 0.52
30 0.44
31 0.4
32 0.43
33 0.37
34 0.31
35 0.22
36 0.18
37 0.13
38 0.12
39 0.11
40 0.06
41 0.06
42 0.05
43 0.05
44 0.08
45 0.09
46 0.12
47 0.2
48 0.24
49 0.33
50 0.4
51 0.48
52 0.51
53 0.53
54 0.55
55 0.51
56 0.56
57 0.58
58 0.61
59 0.62
60 0.66
61 0.72
62 0.77
63 0.84
64 0.84
65 0.84
66 0.86
67 0.88
68 0.89
69 0.9
70 0.88
71 0.86
72 0.83
73 0.81
74 0.81
75 0.78
76 0.74
77 0.66
78 0.67
79 0.66
80 0.66
81 0.65
82 0.61
83 0.62
84 0.59
85 0.66
86 0.61
87 0.58
88 0.52
89 0.46
90 0.44
91 0.36
92 0.34
93 0.27
94 0.25
95 0.2
96 0.2
97 0.21
98 0.16
99 0.15
100 0.13
101 0.11
102 0.08
103 0.08
104 0.09
105 0.07
106 0.09
107 0.17
108 0.23
109 0.26
110 0.35
111 0.42
112 0.48
113 0.55
114 0.61