Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q10273

Protein Details
Accession Q10273    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-117SRRIDVPRPTSKKKRLYKETPDLDEPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
KEGG spo:SPAC13G7.09c  -  
Amino Acid Sequences MESSLDRLNFDEFVAKLLIHESKKKNKSFVDHGYIEKEKTKLRPNKVFLNNMVRNVQSHNRGINNRRRDQKRKQLISIKQDNDLNVSSERLSRRIDVPRPTSKKKRLYKETPDLDEPGSREKRVSQKGQLKIEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.12
4 0.15
5 0.2
6 0.19
7 0.28
8 0.34
9 0.44
10 0.53
11 0.57
12 0.61
13 0.6
14 0.64
15 0.65
16 0.65
17 0.62
18 0.56
19 0.54
20 0.53
21 0.5
22 0.44
23 0.38
24 0.33
25 0.29
26 0.32
27 0.4
28 0.42
29 0.5
30 0.58
31 0.59
32 0.66
33 0.69
34 0.68
35 0.62
36 0.64
37 0.57
38 0.5
39 0.47
40 0.37
41 0.32
42 0.31
43 0.3
44 0.24
45 0.24
46 0.24
47 0.27
48 0.32
49 0.38
50 0.43
51 0.47
52 0.5
53 0.57
54 0.63
55 0.67
56 0.71
57 0.75
58 0.77
59 0.73
60 0.74
61 0.74
62 0.73
63 0.74
64 0.73
65 0.64
66 0.56
67 0.52
68 0.45
69 0.39
70 0.32
71 0.25
72 0.16
73 0.16
74 0.13
75 0.16
76 0.17
77 0.17
78 0.18
79 0.18
80 0.22
81 0.3
82 0.36
83 0.4
84 0.45
85 0.53
86 0.6
87 0.67
88 0.72
89 0.73
90 0.77
91 0.79
92 0.82
93 0.82
94 0.85
95 0.86
96 0.86
97 0.85
98 0.81
99 0.75
100 0.66
101 0.58
102 0.51
103 0.42
104 0.41
105 0.37
106 0.31
107 0.3
108 0.34
109 0.42
110 0.48
111 0.54
112 0.55
113 0.6
114 0.68
115 0.77