Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1YM25

Protein Details
Accession A0A0D1YM25    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-25ADSSPSTPPRRRRLTRDQRRDILLHydrophilic
NLS Segment(s)
PositionSequence
65-70RRPRPS
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MADSSPSTPPRRRRLTRDQRRDILLMRRLGYTYQYIAEFLKISQRAVQYTCQSGQASPQHRNAGRRPRPSKEGTDSRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.86
4 0.88
5 0.87
6 0.82
7 0.78
8 0.72
9 0.65
10 0.62
11 0.57
12 0.49
13 0.41
14 0.37
15 0.33
16 0.31
17 0.28
18 0.21
19 0.15
20 0.13
21 0.12
22 0.12
23 0.11
24 0.11
25 0.1
26 0.08
27 0.12
28 0.12
29 0.12
30 0.14
31 0.15
32 0.16
33 0.18
34 0.22
35 0.19
36 0.21
37 0.22
38 0.22
39 0.21
40 0.2
41 0.24
42 0.28
43 0.31
44 0.32
45 0.37
46 0.42
47 0.45
48 0.51
49 0.54
50 0.58
51 0.62
52 0.68
53 0.7
54 0.69
55 0.74
56 0.74
57 0.74
58 0.72
59 0.74