Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P40923

Protein Details
Accession P40923    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-47DEETHQKKRRRRTTDAEATLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0003714  F:transcription corepressor activity  
GO:0030154  P:cell differentiation  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0071930  P:negative regulation of transcription involved in G1/S transition of mitotic cell cycle  
GO:0071931  P:positive regulation of transcription involved in G1/S transition of mitotic cell cycle  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG spo:SPBC21B10.13c  -  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MSLSDSPSKSGNTGKDLISNNEAKNHEDEETHQKKRRRRTTDAEATLLEQYFLKTPKPSLIERQELSKKLKSSMTPRELQIWFQNKRQSLRRSNCLSRNRLEGTGENSLLRRKSTLTLCETSTGQAELFFQSWPLHSQSVVGEMIHHEQDDYNKENKQQKVVDTTKDISRGSNGNEDSAAHQELEECARSLVELQQQCNDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.37
4 0.39
5 0.39
6 0.4
7 0.35
8 0.39
9 0.4
10 0.35
11 0.36
12 0.33
13 0.29
14 0.24
15 0.27
16 0.31
17 0.38
18 0.44
19 0.48
20 0.53
21 0.59
22 0.69
23 0.75
24 0.73
25 0.73
26 0.74
27 0.78
28 0.82
29 0.8
30 0.71
31 0.61
32 0.54
33 0.47
34 0.38
35 0.27
36 0.16
37 0.13
38 0.13
39 0.14
40 0.14
41 0.14
42 0.15
43 0.2
44 0.24
45 0.25
46 0.31
47 0.37
48 0.42
49 0.41
50 0.47
51 0.48
52 0.49
53 0.51
54 0.47
55 0.42
56 0.38
57 0.41
58 0.38
59 0.4
60 0.46
61 0.46
62 0.44
63 0.43
64 0.47
65 0.44
66 0.41
67 0.4
68 0.39
69 0.36
70 0.37
71 0.42
72 0.38
73 0.42
74 0.49
75 0.49
76 0.51
77 0.55
78 0.59
79 0.61
80 0.64
81 0.68
82 0.67
83 0.63
84 0.55
85 0.54
86 0.48
87 0.42
88 0.36
89 0.29
90 0.26
91 0.24
92 0.22
93 0.17
94 0.16
95 0.18
96 0.17
97 0.16
98 0.12
99 0.11
100 0.15
101 0.18
102 0.22
103 0.25
104 0.26
105 0.27
106 0.28
107 0.27
108 0.23
109 0.2
110 0.16
111 0.11
112 0.09
113 0.09
114 0.08
115 0.08
116 0.08
117 0.08
118 0.08
119 0.09
120 0.11
121 0.12
122 0.12
123 0.11
124 0.12
125 0.12
126 0.14
127 0.14
128 0.11
129 0.09
130 0.1
131 0.13
132 0.12
133 0.12
134 0.09
135 0.09
136 0.13
137 0.17
138 0.2
139 0.21
140 0.23
141 0.3
142 0.37
143 0.39
144 0.43
145 0.42
146 0.42
147 0.48
148 0.5
149 0.48
150 0.46
151 0.46
152 0.43
153 0.43
154 0.4
155 0.31
156 0.31
157 0.29
158 0.27
159 0.32
160 0.29
161 0.26
162 0.26
163 0.26
164 0.25
165 0.25
166 0.23
167 0.15
168 0.14
169 0.14
170 0.15
171 0.18
172 0.17
173 0.14
174 0.13
175 0.13
176 0.13
177 0.14
178 0.17
179 0.22
180 0.25
181 0.26