Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1YN68

Protein Details
Accession A0A0D1YN68    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
413-433GAFLKRQPKNWGRRNSLEDLKHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 15, cyto 7, cyto_nucl 6, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR004567  Type_II_PanK  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004594  F:pantothenate kinase activity  
GO:0015937  P:coenzyme A biosynthetic process  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF03630  Fumble  
Amino Acid Sequences MAALERPLADTDFEDASAIIDVDGPVRPPRAPPIPASVKINVEGAFIVDEDVCGRNGAGSEFVHWDRHDIRLPHHTDVVSHVAVDIGGSLAKLVYFSREPGSTHGGGRLNFVNFETDRLDLCIDFIQELKQTHSKLNGSAPHQLCVMATGGGAFKFYNRMREVLHVDVIQEDEMECLIIGLDFFITEIPGEVFTYSEDEPIQFVEARADVYPYLLVNIGSGVSMVKVSGPGEFQRVGGTSLGGGTFWGILSLLTGARTFDEMLALAEKGDNSGVDMLVGDIYGTGYSKIGLKATTIASTFGKVFRMKRLAERNAEDGEGLSNGDPHDEDEGRVQGFKIEDMARSLLYAISNNIGQIAYLQSEKHNLKHIYFGGSFIRGHTQTMNTLSYAIKFWSKGEKQAYFLRHEGYLGSVGAFLKRQPKNWGRRNSLEDLKLGRVLSKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.11
5 0.1
6 0.07
7 0.07
8 0.07
9 0.08
10 0.09
11 0.11
12 0.13
13 0.15
14 0.16
15 0.18
16 0.26
17 0.32
18 0.34
19 0.35
20 0.42
21 0.48
22 0.51
23 0.54
24 0.5
25 0.44
26 0.43
27 0.42
28 0.32
29 0.25
30 0.22
31 0.17
32 0.13
33 0.11
34 0.11
35 0.08
36 0.07
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.08
43 0.09
44 0.1
45 0.11
46 0.1
47 0.12
48 0.17
49 0.19
50 0.21
51 0.2
52 0.25
53 0.23
54 0.28
55 0.32
56 0.29
57 0.33
58 0.39
59 0.44
60 0.42
61 0.44
62 0.39
63 0.33
64 0.35
65 0.36
66 0.26
67 0.21
68 0.18
69 0.15
70 0.14
71 0.13
72 0.09
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.09
82 0.09
83 0.12
84 0.14
85 0.16
86 0.17
87 0.2
88 0.26
89 0.24
90 0.24
91 0.28
92 0.28
93 0.27
94 0.29
95 0.28
96 0.23
97 0.22
98 0.22
99 0.21
100 0.17
101 0.19
102 0.18
103 0.15
104 0.15
105 0.16
106 0.16
107 0.11
108 0.12
109 0.11
110 0.1
111 0.1
112 0.1
113 0.1
114 0.12
115 0.14
116 0.17
117 0.2
118 0.21
119 0.23
120 0.28
121 0.28
122 0.27
123 0.32
124 0.33
125 0.32
126 0.39
127 0.38
128 0.33
129 0.32
130 0.3
131 0.24
132 0.2
133 0.17
134 0.08
135 0.07
136 0.06
137 0.07
138 0.06
139 0.07
140 0.06
141 0.06
142 0.12
143 0.14
144 0.2
145 0.21
146 0.22
147 0.23
148 0.28
149 0.32
150 0.27
151 0.28
152 0.21
153 0.2
154 0.19
155 0.18
156 0.13
157 0.09
158 0.07
159 0.05
160 0.05
161 0.04
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.02
168 0.02
169 0.02
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.08
182 0.07
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.09
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.06
197 0.06
198 0.06
199 0.05
200 0.06
201 0.05
202 0.05
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.04
216 0.06
217 0.06
218 0.09
219 0.09
220 0.09
221 0.1
222 0.1
223 0.11
224 0.09
225 0.09
226 0.06
227 0.06
228 0.06
229 0.05
230 0.04
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.04
239 0.04
240 0.04
241 0.05
242 0.05
243 0.05
244 0.06
245 0.06
246 0.05
247 0.06
248 0.05
249 0.06
250 0.06
251 0.06
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.04
259 0.05
260 0.05
261 0.04
262 0.05
263 0.04
264 0.04
265 0.04
266 0.03
267 0.03
268 0.03
269 0.03
270 0.03
271 0.04
272 0.04
273 0.04
274 0.06
275 0.07
276 0.08
277 0.08
278 0.08
279 0.11
280 0.12
281 0.13
282 0.12
283 0.13
284 0.13
285 0.14
286 0.14
287 0.13
288 0.16
289 0.17
290 0.19
291 0.25
292 0.3
293 0.3
294 0.38
295 0.47
296 0.5
297 0.53
298 0.54
299 0.51
300 0.46
301 0.45
302 0.36
303 0.27
304 0.2
305 0.14
306 0.11
307 0.07
308 0.07
309 0.07
310 0.07
311 0.07
312 0.07
313 0.11
314 0.11
315 0.12
316 0.13
317 0.16
318 0.15
319 0.16
320 0.15
321 0.13
322 0.13
323 0.13
324 0.14
325 0.14
326 0.14
327 0.16
328 0.17
329 0.15
330 0.14
331 0.15
332 0.12
333 0.11
334 0.11
335 0.09
336 0.1
337 0.1
338 0.1
339 0.1
340 0.09
341 0.08
342 0.08
343 0.08
344 0.08
345 0.09
346 0.1
347 0.11
348 0.19
349 0.21
350 0.23
351 0.31
352 0.32
353 0.32
354 0.38
355 0.39
356 0.37
357 0.35
358 0.35
359 0.29
360 0.29
361 0.28
362 0.23
363 0.27
364 0.21
365 0.23
366 0.23
367 0.22
368 0.23
369 0.27
370 0.27
371 0.2
372 0.22
373 0.21
374 0.19
375 0.19
376 0.17
377 0.16
378 0.16
379 0.18
380 0.27
381 0.29
382 0.35
383 0.42
384 0.43
385 0.45
386 0.52
387 0.54
388 0.49
389 0.49
390 0.44
391 0.36
392 0.33
393 0.29
394 0.24
395 0.21
396 0.16
397 0.14
398 0.13
399 0.13
400 0.14
401 0.14
402 0.15
403 0.23
404 0.27
405 0.31
406 0.4
407 0.5
408 0.59
409 0.68
410 0.75
411 0.74
412 0.8
413 0.82
414 0.8
415 0.79
416 0.71
417 0.66
418 0.6
419 0.55
420 0.49
421 0.42