Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9UTA5

Protein Details
Accession Q9UTA5   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
210-236KEQLERQVEKRMKPRRKLRNMDDYLVQHydrophilic
NLS Segment(s)
PositionSequence
219-226KRMKPRRK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.333, mito_nucl 9.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003827  tRNA_yW-synthesising  
IPR036602  tRNA_yW-synthesising-like_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0008175  F:tRNA methyltransferase activity  
GO:0031591  P:wybutosine biosynthetic process  
KEGG spo:SPAC25B8.15c  -  
Pfam View protein in Pfam  
PF02676  TYW3  
Amino Acid Sequences MNIKGIDVSFDAQKKEILEGLKSSVPDASPKGHPDSPIFPLLDVINSHPDWVTTSSCSGRISVYVQGANSRKGGGYWLFVSHQAHEELPPVLEDEKVEYGKVPSSPVEGNREIQYAFEPMILHVQTRSLANAQHLQRVAASCGFRETGIQGSEQKFIVAIRTSLRMDIPIGCLTASEKLQFYITREYMCFLFKRSVEYFTENGNRMARLKEQLERQVEKRMKPRRKLRNMDDYLVQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.21
5 0.21
6 0.21
7 0.24
8 0.24
9 0.24
10 0.22
11 0.2
12 0.19
13 0.2
14 0.21
15 0.21
16 0.23
17 0.26
18 0.32
19 0.33
20 0.34
21 0.35
22 0.37
23 0.37
24 0.37
25 0.33
26 0.27
27 0.26
28 0.24
29 0.21
30 0.18
31 0.16
32 0.17
33 0.16
34 0.17
35 0.15
36 0.15
37 0.16
38 0.17
39 0.17
40 0.13
41 0.17
42 0.18
43 0.19
44 0.2
45 0.18
46 0.16
47 0.15
48 0.16
49 0.16
50 0.17
51 0.17
52 0.16
53 0.22
54 0.24
55 0.24
56 0.22
57 0.19
58 0.16
59 0.15
60 0.18
61 0.13
62 0.13
63 0.13
64 0.14
65 0.14
66 0.17
67 0.17
68 0.15
69 0.16
70 0.15
71 0.14
72 0.13
73 0.13
74 0.12
75 0.11
76 0.1
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.1
83 0.1
84 0.1
85 0.1
86 0.1
87 0.11
88 0.12
89 0.11
90 0.09
91 0.11
92 0.12
93 0.14
94 0.19
95 0.19
96 0.2
97 0.2
98 0.2
99 0.18
100 0.16
101 0.15
102 0.1
103 0.09
104 0.08
105 0.07
106 0.07
107 0.1
108 0.09
109 0.09
110 0.08
111 0.08
112 0.08
113 0.08
114 0.09
115 0.07
116 0.08
117 0.1
118 0.16
119 0.17
120 0.2
121 0.2
122 0.19
123 0.19
124 0.19
125 0.18
126 0.15
127 0.14
128 0.11
129 0.12
130 0.12
131 0.11
132 0.11
133 0.11
134 0.1
135 0.11
136 0.12
137 0.15
138 0.16
139 0.18
140 0.17
141 0.16
142 0.13
143 0.13
144 0.14
145 0.11
146 0.1
147 0.1
148 0.14
149 0.14
150 0.15
151 0.15
152 0.13
153 0.13
154 0.13
155 0.15
156 0.12
157 0.12
158 0.11
159 0.11
160 0.11
161 0.13
162 0.13
163 0.11
164 0.11
165 0.12
166 0.14
167 0.15
168 0.17
169 0.22
170 0.22
171 0.23
172 0.23
173 0.24
174 0.23
175 0.25
176 0.22
177 0.18
178 0.22
179 0.2
180 0.26
181 0.26
182 0.29
183 0.3
184 0.34
185 0.32
186 0.33
187 0.39
188 0.35
189 0.36
190 0.34
191 0.32
192 0.29
193 0.31
194 0.28
195 0.28
196 0.31
197 0.33
198 0.39
199 0.45
200 0.52
201 0.54
202 0.53
203 0.57
204 0.59
205 0.6
206 0.63
207 0.65
208 0.68
209 0.73
210 0.81
211 0.82
212 0.87
213 0.9
214 0.9
215 0.9
216 0.87
217 0.8