Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1ZHT4

Protein Details
Accession A0A0D1ZHT4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-45QTPKVEPQEKKKTPKGRAKKRITYTRRFVHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) mito 11, cyto 10, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRITYTRRFVNVTMTGGKRKVGHVAFNRIAARKIYTDAYQKFADEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.47
4 0.48
5 0.5
6 0.59
7 0.62
8 0.67
9 0.67
10 0.69
11 0.72
12 0.74
13 0.77
14 0.76
15 0.78
16 0.77
17 0.81
18 0.82
19 0.82
20 0.85
21 0.87
22 0.87
23 0.86
24 0.87
25 0.84
26 0.81
27 0.76
28 0.73
29 0.68
30 0.6
31 0.52
32 0.46
33 0.41
34 0.35
35 0.33
36 0.27
37 0.26
38 0.25
39 0.27
40 0.22
41 0.21
42 0.26
43 0.23
44 0.3
45 0.33
46 0.41
47 0.4
48 0.44
49 0.46
50 0.4
51 0.41
52 0.34
53 0.31
54 0.24
55 0.25
56 0.23
57 0.25
58 0.32
59 0.33
60 0.36
61 0.34