Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40381

Protein Details
Accession P40381    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
136-161GGRPEPSKRKRTARPKKPEAKEPSPKBasic
NLS Segment(s)
PositionSequence
138-164RPEPSKRKRTARPKKPEAKEPSPKSRK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
IPR008251  Chromo_shadow_dom  
IPR023779  Chromodomain_CS  
Gene Ontology GO:0000785  C:chromatin  
GO:0099115  C:chromosome, subtelomeric region  
GO:0000779  C:condensed chromosome, centromeric region  
GO:0000792  C:heterochromatin  
GO:1990342  C:heterochromatin island  
GO:0031934  C:mating-type region heterochromatin  
GO:0005634  C:nucleus  
GO:0005721  C:pericentric heterochromatin  
GO:0003682  F:chromatin binding  
GO:0140463  F:chromatin-protein adaptor activity  
GO:0042393  F:histone binding  
GO:0140566  F:histone reader activity  
GO:0042802  F:identical protein binding  
GO:0035064  F:methylated histone binding  
GO:0003723  F:RNA binding  
GO:0006325  P:chromatin organization  
GO:0007534  P:gene conversion at mating-type locus  
GO:0033696  P:heterochromatin boundary formation  
GO:0007533  P:mating type switching  
GO:1990813  P:meiotic centromeric cohesion protection  
GO:1990758  P:mitotic sister chromatid biorientation  
GO:0071962  P:mitotic sister chromatid cohesion, centromeric  
GO:0044820  P:mitotic telomere tethering at nuclear periphery  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0090053  P:positive regulation of pericentric heterochromatin formation  
GO:0030466  P:silent mating-type cassette heterochromatin formation  
KEGG spo:SPAC664.01c  -  
Pfam View protein in Pfam  
PF00385  Chromo  
PF01393  Chromo_shadow  
PROSITE View protein in PROSITE  
PS00598  CHROMO_1  
PS50013  CHROMO_2  
CDD cd18637  CD_Swi6_like  
cd18657  CSD_Swi6  
Amino Acid Sequences MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.65
4 0.63
5 0.63
6 0.6
7 0.57
8 0.49
9 0.42
10 0.39
11 0.37
12 0.32
13 0.27
14 0.24
15 0.19
16 0.16
17 0.16
18 0.12
19 0.12
20 0.12
21 0.15
22 0.2
23 0.23
24 0.23
25 0.22
26 0.25
27 0.24
28 0.23
29 0.24
30 0.22
31 0.22
32 0.22
33 0.21
34 0.17
35 0.17
36 0.18
37 0.16
38 0.16
39 0.16
40 0.14
41 0.14
42 0.15
43 0.18
44 0.23
45 0.3
46 0.34
47 0.38
48 0.45
49 0.53
50 0.62
51 0.69
52 0.71
53 0.69
54 0.67
55 0.63
56 0.56
57 0.51
58 0.42
59 0.33
60 0.26
61 0.18
62 0.14
63 0.11
64 0.11
65 0.08
66 0.06
67 0.06
68 0.05
69 0.06
70 0.06
71 0.07
72 0.11
73 0.18
74 0.22
75 0.24
76 0.32
77 0.4
78 0.45
79 0.48
80 0.48
81 0.46
82 0.43
83 0.43
84 0.37
85 0.34
86 0.28
87 0.28
88 0.25
89 0.19
90 0.18
91 0.16
92 0.16
93 0.13
94 0.15
95 0.12
96 0.13
97 0.14
98 0.16
99 0.15
100 0.14
101 0.13
102 0.11
103 0.11
104 0.1
105 0.1
106 0.09
107 0.1
108 0.11
109 0.12
110 0.13
111 0.11
112 0.1
113 0.11
114 0.12
115 0.14
116 0.13
117 0.15
118 0.15
119 0.17
120 0.17
121 0.17
122 0.16
123 0.15
124 0.18
125 0.19
126 0.26
127 0.35
128 0.42
129 0.49
130 0.55
131 0.62
132 0.68
133 0.75
134 0.78
135 0.8
136 0.83
137 0.85
138 0.89
139 0.84
140 0.84
141 0.82
142 0.8
143 0.79
144 0.75
145 0.76
146 0.74
147 0.72
148 0.67
149 0.63
150 0.61
151 0.58
152 0.61
153 0.58
154 0.61
155 0.61
156 0.63
157 0.62
158 0.55
159 0.52
160 0.47
161 0.43
162 0.34
163 0.32
164 0.26
165 0.24
166 0.27
167 0.25
168 0.25
169 0.23
170 0.21
171 0.21
172 0.22
173 0.21
174 0.18
175 0.19
176 0.21
177 0.22
178 0.25
179 0.28
180 0.29
181 0.3
182 0.3
183 0.28
184 0.27
185 0.24
186 0.22
187 0.19
188 0.16
189 0.16
190 0.18
191 0.17
192 0.12
193 0.16
194 0.18
195 0.19
196 0.19
197 0.18
198 0.2
199 0.24
200 0.23
201 0.19
202 0.17
203 0.17
204 0.21
205 0.24
206 0.22
207 0.25
208 0.27
209 0.32
210 0.36
211 0.4
212 0.4
213 0.37
214 0.34
215 0.29
216 0.26
217 0.22
218 0.18
219 0.13
220 0.1
221 0.09
222 0.1
223 0.1
224 0.16
225 0.17
226 0.21
227 0.26
228 0.34
229 0.44
230 0.48
231 0.51
232 0.56
233 0.65
234 0.7
235 0.75
236 0.72
237 0.72
238 0.72
239 0.72
240 0.7
241 0.61
242 0.55
243 0.5
244 0.45
245 0.41
246 0.42
247 0.39
248 0.32
249 0.32
250 0.31
251 0.26
252 0.29
253 0.27
254 0.2
255 0.19
256 0.18
257 0.15
258 0.13
259 0.14
260 0.1
261 0.08
262 0.08
263 0.09
264 0.1
265 0.1
266 0.12
267 0.12
268 0.12
269 0.13
270 0.14
271 0.13
272 0.15
273 0.15
274 0.14
275 0.14
276 0.15
277 0.15
278 0.14
279 0.13
280 0.11
281 0.11
282 0.13
283 0.15
284 0.21
285 0.28
286 0.31
287 0.34
288 0.34
289 0.35
290 0.41
291 0.47
292 0.47
293 0.49
294 0.54
295 0.59
296 0.64
297 0.68
298 0.69
299 0.71
300 0.74
301 0.74
302 0.73
303 0.67
304 0.64
305 0.67
306 0.58
307 0.49
308 0.4