Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O14076

Protein Details
Accession O14076    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
163-188ISLHSPKESNARKTKKNKNKKKKKRNBasic
NLS Segment(s)
PositionSequence
125-154RRKQELVSKKAEASRKMEVKAPAKESKKRK
170-188ESNARKTKKNKNKKKKKRN
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Gene Ontology GO:0000176  C:nuclear exosome (RNase complex)  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0071028  P:nuclear mRNA surveillance  
GO:0043633  P:polyadenylation-dependent RNA catabolic process  
GO:0006401  P:RNA catabolic process  
GO:0090503  P:RNA phosphodiester bond hydrolysis, exonucleolytic  
KEGG spo:SPACUNK4.11c  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSSKLLSMKFMQRARGIDPKQAEEELSKNIVTDEHWSLAGKVDFLPQKMTRNVEYESGYGGLIEENDLESHSNEPNLVQGRASFGLFNKELGEENVDEKDVSKNEEVDVNGTKITDTSELTERERRKQELVSKKAEASRKMEVKAPAKESKKRKVNELSQDVISLHSPKESNARKTKKNKNKKKKKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.48
4 0.47
5 0.48
6 0.46
7 0.45
8 0.43
9 0.38
10 0.31
11 0.3
12 0.27
13 0.25
14 0.21
15 0.18
16 0.17
17 0.16
18 0.14
19 0.17
20 0.16
21 0.15
22 0.16
23 0.16
24 0.16
25 0.2
26 0.2
27 0.15
28 0.13
29 0.18
30 0.19
31 0.2
32 0.25
33 0.23
34 0.28
35 0.31
36 0.34
37 0.31
38 0.32
39 0.32
40 0.3
41 0.29
42 0.24
43 0.21
44 0.19
45 0.16
46 0.12
47 0.11
48 0.08
49 0.06
50 0.06
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.11
63 0.12
64 0.12
65 0.1
66 0.1
67 0.12
68 0.13
69 0.14
70 0.1
71 0.09
72 0.13
73 0.13
74 0.13
75 0.11
76 0.11
77 0.11
78 0.11
79 0.12
80 0.08
81 0.09
82 0.09
83 0.09
84 0.08
85 0.08
86 0.1
87 0.09
88 0.11
89 0.11
90 0.11
91 0.11
92 0.13
93 0.13
94 0.13
95 0.14
96 0.12
97 0.11
98 0.11
99 0.1
100 0.08
101 0.09
102 0.08
103 0.07
104 0.09
105 0.13
106 0.15
107 0.18
108 0.25
109 0.27
110 0.33
111 0.38
112 0.38
113 0.37
114 0.42
115 0.48
116 0.52
117 0.56
118 0.54
119 0.51
120 0.52
121 0.54
122 0.54
123 0.48
124 0.42
125 0.45
126 0.43
127 0.42
128 0.45
129 0.46
130 0.48
131 0.5
132 0.51
133 0.51
134 0.53
135 0.61
136 0.64
137 0.68
138 0.69
139 0.66
140 0.69
141 0.71
142 0.73
143 0.75
144 0.73
145 0.66
146 0.58
147 0.57
148 0.48
149 0.39
150 0.32
151 0.23
152 0.17
153 0.16
154 0.16
155 0.16
156 0.26
157 0.33
158 0.41
159 0.49
160 0.58
161 0.64
162 0.75
163 0.85
164 0.86
165 0.89
166 0.91
167 0.92
168 0.95