Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O13868

Protein Details
Accession O13868   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKRKAKAKVKPKRRAPPLDTTFTCHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKAKAKVKPKRRA
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 8, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0008023  C:transcription elongation factor complex  
GO:0000993  F:RNA polymerase II complex binding  
GO:0003711  F:transcription elongation factor activity  
GO:0008270  F:zinc ion binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG spo:SPAC1B3.02c  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAKAKVKPKRRAPPLDTTFTCLFCNHEKSVSCSLDKQSGVGNLHCKICGQSHQCLITALSAPIDVYSDWIDACDAVANQAKEVDNINDQEAYSPEAAYEEEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.86
4 0.86
5 0.82
6 0.8
7 0.7
8 0.66
9 0.57
10 0.48
11 0.43
12 0.32
13 0.29
14 0.25
15 0.29
16 0.24
17 0.27
18 0.26
19 0.3
20 0.38
21 0.36
22 0.33
23 0.3
24 0.31
25 0.32
26 0.3
27 0.25
28 0.2
29 0.22
30 0.22
31 0.21
32 0.23
33 0.2
34 0.2
35 0.2
36 0.18
37 0.15
38 0.15
39 0.19
40 0.19
41 0.2
42 0.23
43 0.24
44 0.24
45 0.23
46 0.22
47 0.16
48 0.14
49 0.11
50 0.08
51 0.07
52 0.06
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.07
59 0.06
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.05
66 0.08
67 0.12
68 0.12
69 0.12
70 0.15
71 0.15
72 0.15
73 0.17
74 0.17
75 0.17
76 0.18
77 0.19
78 0.17
79 0.17
80 0.18
81 0.17
82 0.17
83 0.14
84 0.13
85 0.11
86 0.11
87 0.12