FuNGI

O13788

Protein Details

Accession

O13788

Localization Confidence

Medium

Confidence Score

10.5

NoLS Segment(s)

Position	Sequence	Protein Nature
480-500	KLYMKRECQNARKKIEQQLQS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 22.5, cyto_nucl 14, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR009057 Homeobox-like_sf IPR041984 Rsc8/Ssr1/Ssr2_ZZ IPR001005 SANT/Myb IPR017884 SANT_dom IPR032451 SMARCC_C IPR007526 SWIRM IPR036388 WH-like_DNA-bd_sf IPR000433 Znf_ZZ
Gene Ontology	GO:0000785 C:chromatin GO:0005829 C:cytosol GO:0005634 C:nucleus GO:0016586 C:RSC-type complex GO:0016514 C:SWI/SNF complex GO:0003677 F:DNA binding GO:0042393 F:histone binding GO:0008270 F:zinc ion binding GO:0006338 P:chromatin remodeling GO:0006303 P:double-strand break repair via nonhomologous end joining GO:0045893 P:positive regulation of DNA-templated transcription GO:1905168 P:positive regulation of double-strand break repair via homologous recombination GO:0006357 P:regulation of transcription by RNA polymerase II
KEGG	spo:SPAC17G6.10 -
Pfam	View protein in Pfam PF00249 Myb_DNA-binding PF04433 SWIRM PF16495 SWIRM-assoc_1
PROSITE	View protein in PROSITE PS51293 SANT PS50934 SWIRM PS50135 ZF_ZZ_2
CDD	cd00167 SANT cd02336 ZZ_RSC8

Amino Acid Sequences

MSNVTENKHDLHENGVPDSAQPMELDVSKKEDTEPEVRDEAKEFLLSQLPQVEVPEWAQWFDFSKVHEIEKKQNPEFFDGKNTSKTPEVYKEYRDFMISTFRLNSKVYLTFTACRRNLAGDVCAVLRVHRFLEQWGLINYNVNPDTRPSKIGPPSTSHFQILADTPRGLVPLLPPPSSSIPRSKAVTIEDPSIVRTNIYDPSLDDVLKGKGSTPNQKPSLSNLHENNIDQSDSPQHCYCCGNKFNESYYQSQTAQKYNVCISCYQQNRFPSPTTIADYKEVAIQNKIEDDDTWTAQELVLLSEGVEMYSDDWAKVASHVNTKSVEECILKFLNLPSSDKALFKMDKVHTNPVVDSLQGKNPILSVVSFLAKMVPPSSFTQKSSAKEEESDKVKGESVYPKPESESYDVEMNGKSLEDSDSLSELYLTNEEKKMASIIKDSVNVQIKLIESKLSHFDYLDQHIRLKSQELDAFAQATYREKLYMKRECQNARKKIEQQLQSKDTAANGLPVQSSAETSVIPASSMSPS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.3
2	0.29
3	0.25
4	0.22
5	0.23
6	0.18
7	0.14
8	0.11
9	0.11
10	0.12
11	0.15
12	0.17
13	0.17
14	0.22
15	0.22
16	0.23
17	0.23
18	0.25
19	0.27
20	0.32
21	0.34
22	0.34
23	0.37
24	0.38
25	0.37
26	0.36
27	0.33
28	0.26
29	0.24
30	0.19
31	0.18
32	0.22
33	0.21
34	0.2
35	0.21
36	0.21
37	0.2
38	0.21
39	0.19
40	0.15
41	0.17
42	0.19
43	0.16
44	0.16
45	0.16
46	0.15
47	0.18
48	0.2
49	0.2
50	0.18
51	0.24
52	0.25
53	0.3
54	0.36
55	0.37
56	0.44
57	0.51
58	0.58
59	0.56
60	0.58
61	0.56
62	0.55
63	0.55
64	0.46
65	0.46
66	0.42
67	0.41
68	0.44
69	0.42
70	0.39
71	0.38
72	0.39
73	0.36
74	0.39
75	0.43
76	0.42
77	0.48
78	0.49
79	0.48
80	0.47
81	0.43
82	0.35
83	0.28
84	0.34
85	0.27
86	0.25
87	0.25
88	0.26
89	0.27
90	0.27
91	0.27
92	0.22
93	0.25
94	0.25
95	0.25
96	0.27
97	0.29
98	0.33
99	0.41
100	0.38
101	0.36
102	0.35
103	0.33
104	0.33
105	0.3
106	0.27
107	0.18
108	0.19
109	0.17
110	0.17
111	0.15
112	0.13
113	0.12
114	0.12
115	0.13
116	0.14
117	0.15
118	0.15
119	0.2
120	0.2
121	0.21
122	0.2
123	0.21
124	0.18
125	0.2
126	0.19
127	0.19
128	0.19
129	0.17
130	0.17
131	0.18
132	0.22
133	0.21
134	0.24
135	0.21
136	0.28
137	0.35
138	0.4
139	0.4
140	0.41
141	0.44
142	0.46
143	0.46
144	0.39
145	0.33
146	0.27
147	0.26
148	0.23
149	0.22
150	0.19
151	0.16
152	0.16
153	0.16
154	0.16
155	0.14
156	0.12
157	0.1
158	0.15
159	0.18
160	0.18
161	0.18
162	0.21
163	0.25
164	0.28
165	0.29
166	0.28
167	0.29
168	0.32
169	0.34
170	0.32
171	0.3
172	0.3
173	0.33
174	0.29
175	0.27
176	0.25
177	0.23
178	0.24
179	0.23
180	0.19
181	0.13
182	0.12
183	0.12
184	0.13
185	0.13
186	0.12
187	0.1
188	0.14
189	0.15
190	0.15
191	0.13
192	0.12
193	0.13
194	0.13
195	0.13
196	0.1
197	0.14
198	0.19
199	0.28
200	0.32
201	0.39
202	0.42
203	0.44
204	0.43
205	0.43
206	0.48
207	0.42
208	0.43
209	0.36
210	0.35
211	0.35
212	0.35
213	0.32
214	0.23
215	0.2
216	0.14
217	0.13
218	0.17
219	0.17
220	0.2
221	0.2
222	0.19
223	0.21
224	0.23
225	0.24
226	0.24
227	0.27
228	0.27
229	0.29
230	0.3
231	0.31
232	0.36
233	0.36
234	0.33
235	0.31
236	0.31
237	0.29
238	0.32
239	0.32
240	0.28
241	0.27
242	0.24
243	0.23
244	0.23
245	0.24
246	0.2
247	0.18
248	0.18
249	0.22
250	0.27
251	0.26
252	0.28
253	0.29
254	0.32
255	0.34
256	0.33
257	0.28
258	0.27
259	0.27
260	0.26
261	0.24
262	0.22
263	0.21
264	0.2
265	0.18
266	0.19
267	0.18
268	0.16
269	0.15
270	0.14
271	0.13
272	0.13
273	0.13
274	0.1
275	0.08
276	0.12
277	0.12
278	0.12
279	0.12
280	0.12
281	0.11
282	0.11
283	0.11
284	0.07
285	0.06
286	0.05
287	0.05
288	0.05
289	0.05
290	0.05
291	0.04
292	0.04
293	0.04
294	0.04
295	0.06
296	0.06
297	0.05
298	0.05
299	0.06
300	0.06
301	0.07
302	0.1
303	0.11
304	0.17
305	0.18
306	0.2
307	0.21
308	0.21
309	0.21
310	0.19
311	0.19
312	0.14
313	0.14
314	0.16
315	0.15
316	0.15
317	0.14
318	0.14
319	0.18
320	0.18
321	0.2
322	0.17
323	0.2
324	0.22
325	0.21
326	0.22
327	0.21
328	0.21
329	0.19
330	0.26
331	0.26
332	0.32
333	0.35
334	0.4
335	0.38
336	0.38
337	0.37
338	0.32
339	0.3
340	0.22
341	0.21
342	0.17
343	0.19
344	0.2
345	0.2
346	0.17
347	0.16
348	0.16
349	0.14
350	0.12
351	0.1
352	0.09
353	0.1
354	0.1
355	0.09
356	0.11
357	0.11
358	0.11
359	0.1
360	0.09
361	0.11
362	0.15
363	0.22
364	0.23
365	0.25
366	0.31
367	0.35
368	0.38
369	0.42
370	0.42
371	0.36
372	0.37
373	0.39
374	0.39
375	0.38
376	0.36
377	0.31
378	0.28
379	0.28
380	0.25
381	0.25
382	0.27
383	0.29
384	0.35
385	0.36
386	0.35
387	0.36
388	0.38
389	0.38
390	0.34
391	0.32
392	0.26
393	0.27
394	0.27
395	0.26
396	0.24
397	0.2
398	0.16
399	0.13
400	0.1
401	0.08
402	0.09
403	0.08
404	0.09
405	0.1
406	0.11
407	0.11
408	0.11
409	0.1
410	0.09
411	0.1
412	0.11
413	0.12
414	0.14
415	0.15
416	0.16
417	0.16
418	0.17
419	0.18
420	0.19
421	0.19
422	0.19
423	0.21
424	0.24
425	0.26
426	0.26
427	0.31
428	0.35
429	0.33
430	0.3
431	0.29
432	0.27
433	0.27
434	0.27
435	0.23
436	0.16
437	0.19
438	0.25
439	0.25
440	0.24
441	0.22
442	0.25
443	0.26
444	0.32
445	0.36
446	0.32
447	0.33
448	0.33
449	0.34
450	0.32
451	0.32
452	0.28
453	0.27
454	0.29
455	0.29
456	0.31
457	0.3
458	0.3
459	0.26
460	0.24
461	0.19
462	0.19
463	0.17
464	0.15
465	0.17
466	0.19
467	0.26
468	0.34
469	0.44
470	0.47
471	0.53
472	0.61
473	0.68
474	0.76
475	0.79
476	0.79
477	0.77
478	0.8
479	0.79
480	0.8
481	0.8
482	0.79
483	0.77
484	0.78
485	0.74
486	0.67
487	0.61
488	0.52
489	0.44
490	0.39
491	0.3
492	0.24
493	0.21
494	0.2
495	0.19
496	0.18
497	0.19
498	0.16
499	0.16
500	0.14
501	0.14
502	0.12
503	0.12
504	0.14
505	0.12
506	0.12
507	0.11

O13788

3D AlphaFold-predicted Structure Viewer