Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q92356

Protein Details
Accession Q92356    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-98RGANRVRKKMWWKDMRMRLCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, cyto 7, nucl 3, pero 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001388  Synaptobrevin-like  
IPR016444  Synaptobrevin/VAMP  
IPR042855  V_SNARE_CC  
Gene Ontology GO:0051285  C:cell cortex of cell tip  
GO:0032153  C:cell division site  
GO:0051286  C:cell tip  
GO:0005737  C:cytoplasm  
GO:0005768  C:endosome  
GO:0005794  C:Golgi apparatus  
GO:0031097  C:medial cortex  
GO:0090619  C:meiotic spindle pole  
GO:0005886  C:plasma membrane  
GO:0031201  C:SNARE complex  
GO:0005484  F:SNAP receptor activity  
GO:0019905  F:syntaxin binding  
GO:0032120  P:ascospore-type prospore membrane formation  
GO:0006886  P:intracellular protein transport  
GO:0006906  P:vesicle fusion  
KEGG spo:SPAC6G9.11  -  
Pfam View protein in Pfam  
PF00957  Synaptobrevin  
PROSITE View protein in PROSITE  
PS00417  SYNAPTOBREVIN  
PS50892  V_SNARE  
CDD cd15874  R-SNARE_Snc1  
Amino Acid Sequences MSEPYDPYIPAEPSAAVRSGNAAASSTPNMKTAAIQQQIDDTVGIMRENISKVSERGERLDSLQDKTDNLAVSAQGFRRGANRVRKKMWWKDMRMRLCIIIGIIILLVVIIVPIATKFHGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.14
4 0.13
5 0.14
6 0.14
7 0.14
8 0.12
9 0.11
10 0.1
11 0.13
12 0.15
13 0.15
14 0.15
15 0.16
16 0.16
17 0.16
18 0.16
19 0.2
20 0.26
21 0.27
22 0.26
23 0.25
24 0.26
25 0.26
26 0.25
27 0.19
28 0.11
29 0.07
30 0.07
31 0.07
32 0.06
33 0.06
34 0.07
35 0.08
36 0.08
37 0.09
38 0.09
39 0.1
40 0.14
41 0.16
42 0.16
43 0.18
44 0.19
45 0.18
46 0.18
47 0.24
48 0.21
49 0.2
50 0.21
51 0.19
52 0.17
53 0.17
54 0.18
55 0.13
56 0.12
57 0.1
58 0.08
59 0.09
60 0.11
61 0.11
62 0.12
63 0.12
64 0.12
65 0.15
66 0.2
67 0.26
68 0.35
69 0.44
70 0.48
71 0.52
72 0.6
73 0.67
74 0.72
75 0.76
76 0.74
77 0.73
78 0.76
79 0.81
80 0.79
81 0.73
82 0.65
83 0.55
84 0.46
85 0.38
86 0.28
87 0.19
88 0.13
89 0.09
90 0.07
91 0.05
92 0.04
93 0.03
94 0.03
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.03
101 0.04