Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1YE83

Protein Details
Accession A0A0D1YE83    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
152-175VGKNAWTTQKKRRRRDEESKAIASHydrophilic
NLS Segment(s)
PositionSequence
161-167KKRRRRD
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039845  FAM192A  
IPR019331  FAM192A/Fyv6_N  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF10187  FAM192A_Fyv6_N  
Amino Acid Sequences MSRFVPAGTDPGSGSNEKEDDAWTKARQQIEALKKPKPVDEGKQEGGESLYDVLQRNKGKDRFLTPCTFASTAAKQEAFEESIKLKNQFRALDDDEVDFLDSVLESERAKEDAVKKEMSEQLEAFRNQRAKAEKDLLEHEIPEAEERLGAPVGKNAWTTQKKRRRRDEESKAIASNKTRKLSSSADNTPQQPTAPKESGELAKPLEAANQSSPAQVKSTPGVLGLGDYSSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.19
5 0.19
6 0.19
7 0.19
8 0.22
9 0.26
10 0.23
11 0.29
12 0.33
13 0.35
14 0.33
15 0.34
16 0.39
17 0.45
18 0.53
19 0.52
20 0.52
21 0.55
22 0.56
23 0.55
24 0.53
25 0.49
26 0.48
27 0.52
28 0.55
29 0.53
30 0.53
31 0.49
32 0.42
33 0.36
34 0.28
35 0.19
36 0.13
37 0.11
38 0.11
39 0.12
40 0.14
41 0.2
42 0.23
43 0.26
44 0.34
45 0.36
46 0.38
47 0.41
48 0.46
49 0.45
50 0.48
51 0.49
52 0.43
53 0.41
54 0.42
55 0.37
56 0.31
57 0.29
58 0.26
59 0.24
60 0.24
61 0.22
62 0.18
63 0.19
64 0.2
65 0.18
66 0.16
67 0.14
68 0.13
69 0.17
70 0.19
71 0.21
72 0.22
73 0.23
74 0.27
75 0.27
76 0.28
77 0.3
78 0.31
79 0.3
80 0.29
81 0.25
82 0.21
83 0.19
84 0.18
85 0.11
86 0.08
87 0.05
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.07
97 0.1
98 0.15
99 0.2
100 0.23
101 0.23
102 0.23
103 0.26
104 0.29
105 0.27
106 0.23
107 0.17
108 0.17
109 0.21
110 0.22
111 0.19
112 0.19
113 0.21
114 0.19
115 0.24
116 0.25
117 0.24
118 0.28
119 0.33
120 0.31
121 0.31
122 0.33
123 0.33
124 0.28
125 0.26
126 0.21
127 0.16
128 0.14
129 0.12
130 0.1
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.09
140 0.1
141 0.11
142 0.11
143 0.2
144 0.28
145 0.33
146 0.42
147 0.51
148 0.6
149 0.7
150 0.8
151 0.8
152 0.82
153 0.88
154 0.88
155 0.89
156 0.86
157 0.8
158 0.71
159 0.64
160 0.57
161 0.53
162 0.5
163 0.47
164 0.43
165 0.4
166 0.39
167 0.42
168 0.44
169 0.44
170 0.44
171 0.42
172 0.45
173 0.49
174 0.49
175 0.47
176 0.43
177 0.37
178 0.34
179 0.32
180 0.34
181 0.31
182 0.3
183 0.29
184 0.33
185 0.35
186 0.32
187 0.31
188 0.24
189 0.23
190 0.22
191 0.21
192 0.2
193 0.18
194 0.19
195 0.19
196 0.22
197 0.21
198 0.23
199 0.25
200 0.22
201 0.23
202 0.21
203 0.22
204 0.2
205 0.22
206 0.19
207 0.18
208 0.18
209 0.15
210 0.15
211 0.13
212 0.11
213 0.08