Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BRQ3

Protein Details
Accession A0A0D2BRQ3   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MDPPQSSKQTKNRPREVVKVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, mito 9, cyto_nucl 7.333, cyto_pero 7.333, nucl 3.5, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013096  Cupin_2  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Pfam View protein in Pfam  
PF07883  Cupin_2  
CDD cd02234  cupin_BLR7677-like  
Amino Acid Sequences MDPPQSSKQTKNRPREVVKVLYDYRLENAPGKSIVGLQVHLPPGGFTPPHRHGGATVVATVTDGQFLSGMNGNPPVVYEVGQSFMELPGCHHTVAENNSRENPATFTAVFIVDTDVVEDGYGRLTVLDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.78
4 0.75
5 0.69
6 0.66
7 0.58
8 0.52
9 0.47
10 0.39
11 0.33
12 0.28
13 0.25
14 0.23
15 0.22
16 0.21
17 0.19
18 0.19
19 0.17
20 0.15
21 0.18
22 0.14
23 0.14
24 0.12
25 0.15
26 0.16
27 0.15
28 0.15
29 0.11
30 0.11
31 0.12
32 0.12
33 0.1
34 0.17
35 0.2
36 0.24
37 0.25
38 0.24
39 0.22
40 0.25
41 0.26
42 0.18
43 0.15
44 0.11
45 0.1
46 0.1
47 0.1
48 0.07
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.07
56 0.07
57 0.07
58 0.08
59 0.07
60 0.07
61 0.08
62 0.08
63 0.06
64 0.06
65 0.07
66 0.06
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.09
73 0.08
74 0.1
75 0.12
76 0.13
77 0.13
78 0.12
79 0.12
80 0.16
81 0.21
82 0.27
83 0.25
84 0.26
85 0.29
86 0.3
87 0.31
88 0.27
89 0.25
90 0.19
91 0.2
92 0.18
93 0.17
94 0.17
95 0.16
96 0.15
97 0.13
98 0.12
99 0.09
100 0.09
101 0.09
102 0.08
103 0.08
104 0.07
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06