Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O13784

Protein Details
Accession O13784   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-126HAEPIQKVARQQRKQRKNRGKKVFGTGKRLAHydrophilic
NLS Segment(s)
PositionSequence
104-131ARQQRKQRKNRGKKVFGTGKRLAKRKSK
Subcellular Location(s) mito 19, cyto 5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002182  P:cytoplasmic translational elongation  
GO:0006364  P:rRNA processing  
KEGG spo:SPAC17G6.06  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEAVTIRTRKFMTNRLLQRKQMVVDILHPGKANISKNDLREKLGQMYKTDASAVQAFGLRTHYGGGRTTGFALIYDDVEAMKKFEPHYRLVRVGHAEPIQKVARQQRKQRKNRGKKVFGTGKRLAKRKSKQQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.66
4 0.71
5 0.69
6 0.69
7 0.64
8 0.57
9 0.51
10 0.43
11 0.33
12 0.3
13 0.34
14 0.29
15 0.27
16 0.25
17 0.22
18 0.22
19 0.26
20 0.27
21 0.21
22 0.27
23 0.29
24 0.33
25 0.42
26 0.4
27 0.39
28 0.39
29 0.39
30 0.39
31 0.4
32 0.38
33 0.3
34 0.33
35 0.3
36 0.26
37 0.24
38 0.17
39 0.15
40 0.14
41 0.13
42 0.09
43 0.1
44 0.1
45 0.1
46 0.12
47 0.09
48 0.09
49 0.09
50 0.1
51 0.09
52 0.1
53 0.11
54 0.09
55 0.1
56 0.1
57 0.1
58 0.09
59 0.08
60 0.08
61 0.07
62 0.06
63 0.06
64 0.06
65 0.05
66 0.06
67 0.06
68 0.06
69 0.07
70 0.08
71 0.1
72 0.15
73 0.18
74 0.22
75 0.28
76 0.31
77 0.35
78 0.35
79 0.38
80 0.37
81 0.35
82 0.35
83 0.32
84 0.3
85 0.26
86 0.3
87 0.27
88 0.24
89 0.28
90 0.34
91 0.41
92 0.48
93 0.58
94 0.64
95 0.74
96 0.83
97 0.89
98 0.9
99 0.91
100 0.94
101 0.94
102 0.92
103 0.88
104 0.88
105 0.88
106 0.83
107 0.81
108 0.78
109 0.77
110 0.76
111 0.77
112 0.74
113 0.74
114 0.77