Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9HGN2

Protein Details
Accession Q9HGN2   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
143-162HWKPGKSLFRKNKKLPPNFFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037231  NAP-like_sf  
IPR002164  NAP_family  
Gene Ontology GO:0061638  C:CENP-A containing chromatin  
GO:0000785  C:chromatin  
GO:0000775  C:chromosome, centromeric region  
GO:0005654  C:nucleoplasm  
GO:0005634  C:nucleus  
GO:0003682  F:chromatin binding  
GO:0042393  F:histone binding  
GO:0140713  F:histone chaperone activity  
GO:0140898  P:CENP-A eviction from euchromatin  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00956  NAP  
Amino Acid Sequences MEAAQAFENLANLEQEFGKAEIEILKKQNELFQPLFEQRRDILKTINNFWVVVLEAAGDEISQYITPEDSVLLEKLENIYVERFNEKEPRDVRISLTFQPNEYLQDDNLTLVKEVRIKEEKAKDDEGLEKKITKYTSQPVDIHWKPGKSLFRKNKKLPPNFFDYFQWTGEEEDDDFDGATLTIFLAEDLFPNAVKYFTEAMTEEASDEDESVDLEEDEEEEDEEDEEGDEEKQEPPSKKSKKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.11
5 0.11
6 0.1
7 0.11
8 0.15
9 0.18
10 0.22
11 0.24
12 0.26
13 0.27
14 0.28
15 0.34
16 0.32
17 0.35
18 0.32
19 0.3
20 0.34
21 0.39
22 0.44
23 0.38
24 0.37
25 0.32
26 0.38
27 0.39
28 0.35
29 0.33
30 0.34
31 0.38
32 0.4
33 0.43
34 0.36
35 0.33
36 0.32
37 0.27
38 0.22
39 0.17
40 0.12
41 0.07
42 0.05
43 0.06
44 0.05
45 0.04
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.08
65 0.08
66 0.09
67 0.1
68 0.12
69 0.13
70 0.13
71 0.15
72 0.22
73 0.22
74 0.28
75 0.28
76 0.31
77 0.33
78 0.33
79 0.33
80 0.32
81 0.34
82 0.3
83 0.35
84 0.31
85 0.28
86 0.29
87 0.27
88 0.23
89 0.21
90 0.18
91 0.11
92 0.12
93 0.12
94 0.11
95 0.11
96 0.09
97 0.08
98 0.07
99 0.08
100 0.11
101 0.11
102 0.16
103 0.18
104 0.19
105 0.26
106 0.32
107 0.35
108 0.35
109 0.36
110 0.31
111 0.29
112 0.35
113 0.3
114 0.27
115 0.24
116 0.22
117 0.21
118 0.24
119 0.23
120 0.18
121 0.19
122 0.23
123 0.28
124 0.3
125 0.3
126 0.3
127 0.38
128 0.37
129 0.4
130 0.36
131 0.32
132 0.28
133 0.34
134 0.39
135 0.36
136 0.46
137 0.49
138 0.57
139 0.66
140 0.73
141 0.76
142 0.78
143 0.82
144 0.79
145 0.73
146 0.71
147 0.63
148 0.57
149 0.51
150 0.46
151 0.39
152 0.32
153 0.29
154 0.21
155 0.2
156 0.19
157 0.17
158 0.12
159 0.1
160 0.1
161 0.09
162 0.08
163 0.07
164 0.06
165 0.05
166 0.05
167 0.04
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.04
174 0.05
175 0.06
176 0.07
177 0.07
178 0.08
179 0.08
180 0.08
181 0.08
182 0.11
183 0.11
184 0.11
185 0.14
186 0.13
187 0.15
188 0.16
189 0.16
190 0.13
191 0.11
192 0.13
193 0.1
194 0.1
195 0.08
196 0.07
197 0.07
198 0.07
199 0.08
200 0.06
201 0.06
202 0.06
203 0.06
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.08
210 0.08
211 0.08
212 0.07
213 0.07
214 0.08
215 0.07
216 0.08
217 0.09
218 0.11
219 0.16
220 0.24
221 0.27
222 0.32
223 0.42
224 0.51