Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q10108

Protein Details
Accession Q10108   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MQKDIGRRFQRNKKKINSKPGGAMVHydrophilic
NLS Segment(s)
PositionSequence
13-14KK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0005829  C:cytosol  
GO:0098745  C:Dcp1-Dcp2 complex  
GO:0005634  C:nucleus  
GO:0170008  F:mRNA phosphatase activator activity  
GO:0051321  P:meiotic cell cycle  
KEGG spo:SPAC18G6.09c  -  
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MQKDIGRRFQRNKKKINSKPGGAMVASSDVEFSLDGMSIMPQRDGNLQIPNFVKPKSTFATSNIGESNGKRNGDKVRGNRRSKSGHSSYAGSRISGGNSNSHLPSGVASAPAGLGIDKVAVGEVDSHLKSVSSYVSNSSGADRSFSSNSSSDTNSILYAGPTFTHSPAASNLPIPTFLHSPVSEKAEWQPPTGSVNSNMPFQFHQSSSVPSTPSEVAMGHNFCPMSRNDPSLQSIQQTNGFYSGHNSPHTNYSASTPSFNHFNAAGHPTGNITPTLNSPNNGIHCHSTSALDLLFHRDREQRLFRMLRQGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.91
4 0.9
5 0.84
6 0.81
7 0.76
8 0.68
9 0.57
10 0.47
11 0.37
12 0.31
13 0.26
14 0.19
15 0.14
16 0.1
17 0.1
18 0.1
19 0.08
20 0.06
21 0.06
22 0.06
23 0.06
24 0.08
25 0.1
26 0.11
27 0.12
28 0.12
29 0.13
30 0.16
31 0.2
32 0.21
33 0.26
34 0.25
35 0.3
36 0.31
37 0.34
38 0.33
39 0.3
40 0.32
41 0.26
42 0.32
43 0.31
44 0.33
45 0.31
46 0.31
47 0.39
48 0.35
49 0.36
50 0.31
51 0.29
52 0.27
53 0.26
54 0.3
55 0.26
56 0.27
57 0.25
58 0.28
59 0.33
60 0.4
61 0.46
62 0.49
63 0.55
64 0.64
65 0.7
66 0.71
67 0.71
68 0.7
69 0.68
70 0.67
71 0.61
72 0.57
73 0.53
74 0.51
75 0.46
76 0.47
77 0.42
78 0.32
79 0.28
80 0.22
81 0.21
82 0.22
83 0.21
84 0.16
85 0.17
86 0.2
87 0.18
88 0.18
89 0.16
90 0.12
91 0.12
92 0.11
93 0.1
94 0.08
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.08
118 0.09
119 0.07
120 0.08
121 0.09
122 0.11
123 0.12
124 0.12
125 0.13
126 0.13
127 0.11
128 0.12
129 0.11
130 0.12
131 0.13
132 0.13
133 0.14
134 0.13
135 0.15
136 0.16
137 0.16
138 0.14
139 0.14
140 0.14
141 0.11
142 0.11
143 0.09
144 0.07
145 0.07
146 0.06
147 0.05
148 0.07
149 0.08
150 0.08
151 0.1
152 0.1
153 0.1
154 0.12
155 0.14
156 0.12
157 0.13
158 0.13
159 0.11
160 0.12
161 0.11
162 0.12
163 0.11
164 0.11
165 0.13
166 0.13
167 0.15
168 0.16
169 0.2
170 0.18
171 0.18
172 0.2
173 0.26
174 0.26
175 0.25
176 0.23
177 0.2
178 0.23
179 0.23
180 0.21
181 0.15
182 0.2
183 0.2
184 0.22
185 0.21
186 0.2
187 0.19
188 0.21
189 0.23
190 0.17
191 0.2
192 0.18
193 0.21
194 0.23
195 0.25
196 0.22
197 0.19
198 0.22
199 0.18
200 0.18
201 0.15
202 0.12
203 0.12
204 0.15
205 0.17
206 0.14
207 0.16
208 0.15
209 0.14
210 0.17
211 0.16
212 0.18
213 0.19
214 0.22
215 0.22
216 0.25
217 0.29
218 0.3
219 0.3
220 0.27
221 0.26
222 0.24
223 0.27
224 0.25
225 0.22
226 0.21
227 0.2
228 0.17
229 0.19
230 0.21
231 0.2
232 0.21
233 0.22
234 0.22
235 0.27
236 0.29
237 0.26
238 0.23
239 0.23
240 0.26
241 0.26
242 0.27
243 0.23
244 0.24
245 0.27
246 0.26
247 0.25
248 0.2
249 0.2
250 0.21
251 0.23
252 0.21
253 0.17
254 0.17
255 0.17
256 0.17
257 0.17
258 0.14
259 0.12
260 0.12
261 0.15
262 0.23
263 0.23
264 0.23
265 0.24
266 0.29
267 0.32
268 0.33
269 0.33
270 0.3
271 0.3
272 0.32
273 0.3
274 0.26
275 0.24
276 0.23
277 0.2
278 0.17
279 0.16
280 0.21
281 0.23
282 0.23
283 0.26
284 0.3
285 0.34
286 0.41
287 0.48
288 0.45
289 0.51
290 0.56
291 0.56
292 0.61