Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O13744

Protein Details
Accession O13744   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
233-252KTSNCFKKKDHLHRMCLVNRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000235  Ribosomal_S5/S7  
IPR020606  Ribosomal_S7_CS  
IPR023798  Ribosomal_S7_dom  
IPR036823  Ribosomal_S7_dom_sf  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0005840  C:ribosome  
GO:0003729  F:mRNA binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
GO:0000028  P:ribosomal small subunit assembly  
GO:0006412  P:translation  
KEGG spo:SPAC16E8.10c  -  
Pfam View protein in Pfam  
PF00177  Ribosomal_S7  
PROSITE View protein in PROSITE  
PS00052  RIBOSOMAL_S7  
CDD cd14868  uS7_Mitochondria_Fungi  
Amino Acid Sequences MLRLIKQPLFRCASSGHLMKESLVFIHQTRTFQVGKFTSNEKYNEKIEDINERSNPQWDNAGLENLLNQLQDSVEQSASDDFMGELEKKIEVENEEPPLMGTNLWPSPSSSIVGLIDRPFQVDSTVQHLVNLIMRDGKKAKAEKIVATALSIIQKETGENPIDVLKQAIAEISPLMKLVSAKRFNKSVEFPMPLKERQRRRIALQWILGECKSSSPKRLSDRIVKEIIAIRSKTSNCFKKKDHLHRMCLVNRGNAPVRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.35
4 0.32
5 0.32
6 0.3
7 0.31
8 0.26
9 0.2
10 0.17
11 0.16
12 0.14
13 0.21
14 0.23
15 0.22
16 0.23
17 0.27
18 0.28
19 0.26
20 0.33
21 0.28
22 0.28
23 0.3
24 0.32
25 0.33
26 0.37
27 0.4
28 0.37
29 0.39
30 0.39
31 0.39
32 0.37
33 0.34
34 0.31
35 0.36
36 0.36
37 0.37
38 0.37
39 0.36
40 0.35
41 0.37
42 0.36
43 0.27
44 0.27
45 0.21
46 0.22
47 0.21
48 0.22
49 0.17
50 0.16
51 0.15
52 0.13
53 0.13
54 0.09
55 0.08
56 0.06
57 0.06
58 0.07
59 0.08
60 0.09
61 0.08
62 0.08
63 0.09
64 0.09
65 0.1
66 0.09
67 0.07
68 0.05
69 0.05
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.08
77 0.09
78 0.1
79 0.12
80 0.14
81 0.16
82 0.15
83 0.15
84 0.15
85 0.15
86 0.13
87 0.1
88 0.08
89 0.09
90 0.09
91 0.1
92 0.11
93 0.1
94 0.11
95 0.12
96 0.13
97 0.09
98 0.1
99 0.09
100 0.09
101 0.1
102 0.09
103 0.1
104 0.09
105 0.1
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.13
112 0.15
113 0.14
114 0.14
115 0.14
116 0.13
117 0.14
118 0.14
119 0.09
120 0.1
121 0.1
122 0.13
123 0.14
124 0.16
125 0.19
126 0.21
127 0.23
128 0.27
129 0.29
130 0.28
131 0.3
132 0.29
133 0.24
134 0.22
135 0.19
136 0.13
137 0.13
138 0.12
139 0.09
140 0.08
141 0.08
142 0.08
143 0.09
144 0.12
145 0.11
146 0.11
147 0.12
148 0.12
149 0.13
150 0.12
151 0.12
152 0.08
153 0.07
154 0.07
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.06
164 0.07
165 0.11
166 0.2
167 0.28
168 0.31
169 0.34
170 0.38
171 0.39
172 0.43
173 0.43
174 0.41
175 0.38
176 0.4
177 0.37
178 0.4
179 0.43
180 0.43
181 0.48
182 0.49
183 0.53
184 0.58
185 0.66
186 0.64
187 0.67
188 0.71
189 0.7
190 0.69
191 0.64
192 0.6
193 0.52
194 0.5
195 0.43
196 0.36
197 0.28
198 0.25
199 0.27
200 0.26
201 0.31
202 0.33
203 0.41
204 0.46
205 0.54
206 0.56
207 0.6
208 0.64
209 0.64
210 0.61
211 0.54
212 0.5
213 0.49
214 0.47
215 0.43
216 0.37
217 0.32
218 0.36
219 0.38
220 0.42
221 0.46
222 0.5
223 0.5
224 0.58
225 0.6
226 0.63
227 0.73
228 0.77
229 0.78
230 0.78
231 0.79
232 0.79
233 0.83
234 0.77
235 0.75
236 0.67
237 0.63
238 0.56
239 0.55