Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q10154

Protein Details
Accession Q10154    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
178-210KTHSLNKASKKSNKNGDKKRKHVSKSNSKHAKHBasic
NLS Segment(s)
PositionSequence
184-209KASKKSNKNGDKKRKHVSKSNSKHAK
Subcellular Location(s) nucl 22.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
GO:0071171  P:site-specific DNA replication termination at RTS1 barrier  
KEGG spo:SPAC1D4.09c  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSLPTRNELVKEPGKVPPLDIDFKRSVKSSQFSQCAITDEPLYPPIVSCGLGKLYNKASILQMLLDRSSVPKSPSHIKSLKDVVQLQVELDDSGKVLWLCPITRHVMSDTYQFAYIVPCGHVFEYSALKQFGEKMCFQCNQVYEEKDVIPINPNAEQLKTLSKRLLDLALSEKTHSLNKASKKSNKNGDKKRKHVSKSNSKHAKHELRTNRMLDGENVKSETSVTDMERVKRVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.34
4 0.35
5 0.39
6 0.43
7 0.41
8 0.38
9 0.36
10 0.36
11 0.39
12 0.38
13 0.39
14 0.4
15 0.41
16 0.42
17 0.37
18 0.35
19 0.35
20 0.38
21 0.39
22 0.42
23 0.44
24 0.43
25 0.44
26 0.42
27 0.39
28 0.37
29 0.31
30 0.24
31 0.2
32 0.21
33 0.19
34 0.19
35 0.14
36 0.13
37 0.13
38 0.12
39 0.12
40 0.11
41 0.11
42 0.13
43 0.16
44 0.16
45 0.19
46 0.2
47 0.23
48 0.23
49 0.22
50 0.21
51 0.19
52 0.19
53 0.16
54 0.15
55 0.13
56 0.12
57 0.11
58 0.11
59 0.11
60 0.13
61 0.13
62 0.14
63 0.15
64 0.19
65 0.28
66 0.3
67 0.37
68 0.39
69 0.38
70 0.42
71 0.46
72 0.46
73 0.41
74 0.39
75 0.33
76 0.31
77 0.29
78 0.24
79 0.19
80 0.15
81 0.1
82 0.09
83 0.07
84 0.05
85 0.05
86 0.06
87 0.05
88 0.05
89 0.06
90 0.07
91 0.07
92 0.08
93 0.11
94 0.13
95 0.14
96 0.15
97 0.14
98 0.15
99 0.16
100 0.18
101 0.17
102 0.14
103 0.14
104 0.13
105 0.12
106 0.1
107 0.1
108 0.08
109 0.07
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.08
116 0.1
117 0.1
118 0.12
119 0.12
120 0.12
121 0.12
122 0.15
123 0.17
124 0.17
125 0.19
126 0.19
127 0.22
128 0.24
129 0.25
130 0.24
131 0.23
132 0.23
133 0.25
134 0.24
135 0.22
136 0.22
137 0.21
138 0.2
139 0.19
140 0.16
141 0.16
142 0.15
143 0.15
144 0.15
145 0.17
146 0.16
147 0.16
148 0.16
149 0.14
150 0.22
151 0.22
152 0.23
153 0.23
154 0.23
155 0.23
156 0.24
157 0.25
158 0.16
159 0.16
160 0.19
161 0.2
162 0.2
163 0.19
164 0.19
165 0.18
166 0.2
167 0.2
168 0.2
169 0.23
170 0.31
171 0.39
172 0.47
173 0.55
174 0.61
175 0.69
176 0.74
177 0.78
178 0.81
179 0.83
180 0.86
181 0.87
182 0.87
183 0.89
184 0.88
185 0.85
186 0.84
187 0.84
188 0.84
189 0.83
190 0.86
191 0.85
192 0.78
193 0.78
194 0.78
195 0.78
196 0.73
197 0.73
198 0.72
199 0.71
200 0.76
201 0.7
202 0.62
203 0.55
204 0.5
205 0.44
206 0.41
207 0.36
208 0.32
209 0.31
210 0.29
211 0.26
212 0.25
213 0.21
214 0.17
215 0.16
216 0.15
217 0.21
218 0.25
219 0.29
220 0.37