Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74807

Protein Details
Accession O74807    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-110INNFHKESIKSKKKKKENSTTHydrophilic
NLS Segment(s)
PositionSequence
99-105KSKKKKK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0043505  C:CENP-A containing nucleosome  
GO:0061838  C:CENP-T-W-S-X complex  
GO:0071821  C:FANCM-MHF complex  
GO:0003682  F:chromatin binding  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0045003  P:double-strand break repair via synthesis-dependent strand annealing  
GO:0031297  P:replication fork processing  
GO:0000712  P:resolution of meiotic recombination intermediates  
KEGG spo:SPBC2D10.16  -  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MMEEERFKAEIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEMVWEQIRVLAKDIEAFAEHAGRKTVQPQDVLLCCRRNEGLYEIINNFHKESIKSKKKKKENSTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.3
4 0.31
5 0.25
6 0.24
7 0.21
8 0.21
9 0.21
10 0.2
11 0.19
12 0.16
13 0.18
14 0.23
15 0.23
16 0.23
17 0.22
18 0.2
19 0.17
20 0.16
21 0.13
22 0.09
23 0.08
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.06
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.08
39 0.09
40 0.08
41 0.1
42 0.09
43 0.09
44 0.1
45 0.1
46 0.08
47 0.07
48 0.07
49 0.06
50 0.09
51 0.1
52 0.09
53 0.1
54 0.11
55 0.11
56 0.16
57 0.21
58 0.2
59 0.21
60 0.21
61 0.25
62 0.28
63 0.31
64 0.31
65 0.29
66 0.27
67 0.28
68 0.28
69 0.24
70 0.24
71 0.23
72 0.25
73 0.23
74 0.26
75 0.25
76 0.27
77 0.29
78 0.28
79 0.25
80 0.22
81 0.22
82 0.21
83 0.29
84 0.36
85 0.45
86 0.53
87 0.63
88 0.71
89 0.79
90 0.88