Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2BRD9

Protein Details
Accession A0A0D2BRD9    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
115-136DSSPRPPTRRPARPARPARPARBasic
372-399CASQRAAKATPRKKPNSKASQKLEKCVVHydrophilic
NLS Segment(s)
PositionSequence
119-137RPPTRRPARPARPARPARA
383-385RKK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038886  E3_SLX5/Rfp1  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
CDD cd16449  RING-HC  
Amino Acid Sequences MPSAATLSLSNFLNSAASSSASRKRSHAEATRSQTRSLTPEVPAKRRRLSSMSSSPSSLFSGSPPPRPTTTRSERAGYDHRRPAMSTRLNRLSQAPDEGTIDLTGDDSDVTTVTDSSPRPPTRRPARPARPARPARAQSSDNRAPRAPPFSQRRTHQHHDVIDLSEESDFEIDDFTVENDTESVRSVHTLASSPEVQFLREQPAPPGSRRPDPPQPTRRNPSPRHLDGGGPFGYLPDLFRRGTQFMFGMGPNAYDQVFQDHYGGDRLVDLRADDTARGNDDPAELTIQMDYRRPAFALQAFTMLDRSSETPQVVDEPYKAPPPPRDGFIRTFSEDEVVLCPRCGDELAVGKDDTKQQVWVVKSCGHVYCGDCASQRAAKATPRKKPNSKASQKLEKCVVDDCTSKLTGKMAMFPIYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.09
4 0.1
5 0.12
6 0.18
7 0.26
8 0.29
9 0.32
10 0.34
11 0.38
12 0.42
13 0.49
14 0.53
15 0.54
16 0.59
17 0.66
18 0.72
19 0.69
20 0.65
21 0.58
22 0.51
23 0.47
24 0.44
25 0.39
26 0.33
27 0.4
28 0.46
29 0.53
30 0.58
31 0.61
32 0.62
33 0.62
34 0.64
35 0.61
36 0.59
37 0.59
38 0.62
39 0.61
40 0.56
41 0.54
42 0.48
43 0.45
44 0.4
45 0.31
46 0.22
47 0.17
48 0.25
49 0.27
50 0.34
51 0.35
52 0.37
53 0.4
54 0.43
55 0.46
56 0.46
57 0.52
58 0.53
59 0.54
60 0.53
61 0.51
62 0.54
63 0.59
64 0.57
65 0.57
66 0.55
67 0.55
68 0.52
69 0.52
70 0.49
71 0.5
72 0.51
73 0.48
74 0.5
75 0.54
76 0.54
77 0.54
78 0.53
79 0.48
80 0.41
81 0.4
82 0.32
83 0.25
84 0.26
85 0.24
86 0.21
87 0.16
88 0.14
89 0.09
90 0.09
91 0.07
92 0.06
93 0.05
94 0.04
95 0.05
96 0.04
97 0.05
98 0.05
99 0.05
100 0.06
101 0.1
102 0.1
103 0.14
104 0.24
105 0.28
106 0.32
107 0.36
108 0.46
109 0.52
110 0.62
111 0.65
112 0.67
113 0.73
114 0.8
115 0.85
116 0.83
117 0.83
118 0.8
119 0.78
120 0.77
121 0.72
122 0.66
123 0.62
124 0.57
125 0.51
126 0.55
127 0.56
128 0.49
129 0.48
130 0.43
131 0.4
132 0.4
133 0.41
134 0.35
135 0.36
136 0.42
137 0.45
138 0.51
139 0.55
140 0.6
141 0.63
142 0.66
143 0.65
144 0.63
145 0.57
146 0.54
147 0.5
148 0.42
149 0.34
150 0.27
151 0.2
152 0.13
153 0.12
154 0.08
155 0.06
156 0.05
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.06
173 0.07
174 0.07
175 0.08
176 0.09
177 0.08
178 0.11
179 0.12
180 0.11
181 0.15
182 0.15
183 0.14
184 0.14
185 0.15
186 0.17
187 0.18
188 0.18
189 0.15
190 0.21
191 0.22
192 0.23
193 0.29
194 0.27
195 0.31
196 0.34
197 0.39
198 0.42
199 0.48
200 0.56
201 0.59
202 0.65
203 0.68
204 0.72
205 0.74
206 0.75
207 0.72
208 0.71
209 0.7
210 0.63
211 0.59
212 0.53
213 0.47
214 0.38
215 0.37
216 0.29
217 0.2
218 0.17
219 0.13
220 0.12
221 0.09
222 0.09
223 0.07
224 0.1
225 0.1
226 0.11
227 0.14
228 0.16
229 0.16
230 0.16
231 0.14
232 0.13
233 0.14
234 0.13
235 0.11
236 0.1
237 0.1
238 0.09
239 0.09
240 0.08
241 0.07
242 0.07
243 0.09
244 0.1
245 0.1
246 0.11
247 0.1
248 0.11
249 0.12
250 0.12
251 0.08
252 0.08
253 0.08
254 0.08
255 0.08
256 0.07
257 0.07
258 0.08
259 0.08
260 0.08
261 0.09
262 0.1
263 0.12
264 0.12
265 0.12
266 0.11
267 0.11
268 0.12
269 0.1
270 0.11
271 0.09
272 0.09
273 0.09
274 0.1
275 0.11
276 0.12
277 0.13
278 0.12
279 0.13
280 0.13
281 0.13
282 0.16
283 0.18
284 0.2
285 0.19
286 0.2
287 0.19
288 0.19
289 0.19
290 0.15
291 0.12
292 0.1
293 0.12
294 0.13
295 0.15
296 0.15
297 0.14
298 0.15
299 0.18
300 0.18
301 0.16
302 0.16
303 0.15
304 0.17
305 0.2
306 0.21
307 0.23
308 0.27
309 0.33
310 0.34
311 0.36
312 0.4
313 0.42
314 0.45
315 0.46
316 0.45
317 0.4
318 0.39
319 0.36
320 0.31
321 0.26
322 0.22
323 0.19
324 0.17
325 0.15
326 0.14
327 0.14
328 0.12
329 0.13
330 0.13
331 0.11
332 0.12
333 0.19
334 0.22
335 0.24
336 0.24
337 0.24
338 0.26
339 0.3
340 0.29
341 0.23
342 0.21
343 0.22
344 0.28
345 0.3
346 0.31
347 0.31
348 0.31
349 0.33
350 0.35
351 0.33
352 0.29
353 0.3
354 0.28
355 0.29
356 0.27
357 0.26
358 0.23
359 0.24
360 0.27
361 0.26
362 0.26
363 0.25
364 0.27
365 0.32
366 0.42
367 0.49
368 0.54
369 0.62
370 0.71
371 0.77
372 0.84
373 0.87
374 0.87
375 0.89
376 0.9
377 0.89
378 0.9
379 0.85
380 0.82
381 0.79
382 0.7
383 0.62
384 0.56
385 0.51
386 0.44
387 0.42
388 0.37
389 0.34
390 0.33
391 0.32
392 0.29
393 0.26
394 0.27
395 0.26
396 0.3
397 0.29