Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O14199

Protein Details
Accession O14199    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-42LVGRNAIKSSKKKPFQKHLLVFFGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 5, mito 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013969  Oligosacch_biosynth_Alg14  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0031965  C:nuclear membrane  
GO:0043541  C:UDP-N-acetylglucosamine transferase complex  
GO:0006488  P:dolichol-linked oligosaccharide biosynthetic process  
KEGG spo:SPAC5D6.06c  -  
Pfam View protein in Pfam  
PF08660  Alg14  
Amino Acid Sequences MNTYVLTAIAVLASLIILLVGRNAIKSSKKKPFQKHLLVFFGSGGHTGEMLNLLNALDDKLYSVRSYVAGSDDTMSVSKASLLSNSLPSVKSKIFKVPRARYVKQSWLTTPFTAFWSLLGSISVIFWNPFGIPDVILCNGPGTCVFICLLGYLAKFLGKNVKIVYVESFARVKSLSLSGKILMPFVDRFLVQWPDLATKYKRAEYIGIVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.03
5 0.03
6 0.03
7 0.05
8 0.05
9 0.06
10 0.08
11 0.12
12 0.2
13 0.28
14 0.38
15 0.47
16 0.56
17 0.66
18 0.75
19 0.82
20 0.84
21 0.87
22 0.86
23 0.82
24 0.78
25 0.7
26 0.6
27 0.49
28 0.4
29 0.29
30 0.21
31 0.15
32 0.09
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.04
45 0.04
46 0.05
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.09
54 0.09
55 0.1
56 0.09
57 0.1
58 0.1
59 0.1
60 0.09
61 0.09
62 0.09
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.08
70 0.09
71 0.1
72 0.11
73 0.12
74 0.11
75 0.12
76 0.15
77 0.15
78 0.16
79 0.16
80 0.25
81 0.29
82 0.36
83 0.45
84 0.48
85 0.55
86 0.62
87 0.62
88 0.6
89 0.59
90 0.6
91 0.54
92 0.5
93 0.42
94 0.39
95 0.4
96 0.33
97 0.3
98 0.22
99 0.19
100 0.18
101 0.16
102 0.11
103 0.1
104 0.1
105 0.09
106 0.08
107 0.07
108 0.06
109 0.06
110 0.06
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.05
117 0.07
118 0.07
119 0.07
120 0.07
121 0.09
122 0.09
123 0.09
124 0.09
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.08
131 0.09
132 0.09
133 0.08
134 0.08
135 0.08
136 0.09
137 0.07
138 0.07
139 0.07
140 0.07
141 0.08
142 0.08
143 0.09
144 0.17
145 0.17
146 0.19
147 0.2
148 0.24
149 0.23
150 0.24
151 0.26
152 0.21
153 0.2
154 0.21
155 0.21
156 0.16
157 0.17
158 0.16
159 0.14
160 0.13
161 0.18
162 0.19
163 0.2
164 0.22
165 0.21
166 0.25
167 0.25
168 0.23
169 0.18
170 0.18
171 0.16
172 0.16
173 0.17
174 0.13
175 0.14
176 0.18
177 0.21
178 0.18
179 0.2
180 0.2
181 0.23
182 0.25
183 0.3
184 0.28
185 0.33
186 0.39
187 0.41
188 0.41
189 0.4
190 0.41