Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1ZU29

Protein Details
Accession A0A0D1ZU29    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-21DKIKALFKRKKDKPSSTAGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDKIKALFKRKKDKPSSTAGTKTEAPADAAVPKPAETAAPSTADPTTAPAGAAPVDAPAADTPAEPASTETPAVEPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.78
4 0.75
5 0.72
6 0.63
7 0.57
8 0.49
9 0.44
10 0.37
11 0.29
12 0.23
13 0.16
14 0.16
15 0.14
16 0.14
17 0.14
18 0.12
19 0.11
20 0.1
21 0.1
22 0.09
23 0.07
24 0.09
25 0.09
26 0.1
27 0.1
28 0.11
29 0.11
30 0.11
31 0.1
32 0.1
33 0.1
34 0.08
35 0.08
36 0.07
37 0.08
38 0.07
39 0.08
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.08
50 0.09
51 0.1
52 0.09
53 0.11
54 0.12
55 0.14
56 0.14
57 0.13
58 0.13