Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SVX8

Protein Details
Accession R7SVX8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
333-358GWFASERKLLRRRRMRWIRRPVLEWLHydrophilic
NLS Segment(s)
PositionSequence
340-350KLLRRRRMRWI
Subcellular Location(s) mito 17, cyto 7, cyto_nucl 4.833, cyto_pero 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
IPR012020  ABHD4  
Gene Ontology GO:0016787  F:hydrolase activity  
KEGG dsq:DICSQDRAFT_88166  -  
Pfam View protein in Pfam  
PF00561  Abhydrolase_1  
Amino Acid Sequences MRLRDFVCSKCPSLLEEFKPSRLLFNGHLQTAYSAYGDFSEVDRIMYDRKLIRLLDGGTLSLDFTPPEDERRLPDDIPIIVTFHGLTGGSNEAYVRAILAPACAPVEEGGLGYRAVVVNYRGCAGTPVTSEKLYHCGNTDDARQALMYISHRYPKAKLIGLGFSLGANILVRYLAQEGEQSRLVAGCALGCPWDLHSVSYKLSNGAWVDRMYSRMLAENMATLIKANKDVLANNPKLAKALPYLFSLPSPTLWDFDIYYAYEEKTEELEMLGTFRDQGDFYRWASSHTALSDVRVPLLAINADDDPIVRDLPVDVGGNSLVSLVVTQGGGHLGWFASERKLLRRRRMRWIRRPVLEWLRAVGQDLVVDFPRCQPLREVHGFICEVGRTGLGCRQVDGGGKFPGEMLQVGRTGLMAGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.48
4 0.49
5 0.48
6 0.52
7 0.49
8 0.44
9 0.38
10 0.37
11 0.31
12 0.38
13 0.4
14 0.36
15 0.36
16 0.33
17 0.31
18 0.28
19 0.25
20 0.15
21 0.1
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.13
28 0.13
29 0.13
30 0.13
31 0.14
32 0.16
33 0.16
34 0.21
35 0.2
36 0.22
37 0.26
38 0.26
39 0.27
40 0.29
41 0.29
42 0.27
43 0.25
44 0.22
45 0.18
46 0.18
47 0.17
48 0.12
49 0.11
50 0.07
51 0.07
52 0.11
53 0.12
54 0.16
55 0.19
56 0.2
57 0.24
58 0.28
59 0.31
60 0.27
61 0.29
62 0.28
63 0.25
64 0.27
65 0.23
66 0.2
67 0.16
68 0.16
69 0.13
70 0.1
71 0.1
72 0.07
73 0.06
74 0.07
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.09
82 0.07
83 0.06
84 0.07
85 0.07
86 0.08
87 0.07
88 0.07
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.07
98 0.07
99 0.06
100 0.07
101 0.06
102 0.06
103 0.08
104 0.09
105 0.1
106 0.11
107 0.12
108 0.11
109 0.11
110 0.12
111 0.12
112 0.12
113 0.12
114 0.16
115 0.17
116 0.18
117 0.18
118 0.18
119 0.22
120 0.21
121 0.2
122 0.17
123 0.17
124 0.19
125 0.2
126 0.22
127 0.2
128 0.19
129 0.18
130 0.17
131 0.15
132 0.13
133 0.13
134 0.12
135 0.14
136 0.15
137 0.19
138 0.21
139 0.22
140 0.24
141 0.26
142 0.29
143 0.27
144 0.28
145 0.26
146 0.27
147 0.25
148 0.25
149 0.19
150 0.14
151 0.12
152 0.09
153 0.07
154 0.05
155 0.04
156 0.03
157 0.03
158 0.03
159 0.04
160 0.05
161 0.05
162 0.05
163 0.08
164 0.08
165 0.11
166 0.12
167 0.11
168 0.1
169 0.1
170 0.1
171 0.08
172 0.07
173 0.05
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.06
180 0.09
181 0.09
182 0.09
183 0.12
184 0.13
185 0.13
186 0.15
187 0.14
188 0.12
189 0.12
190 0.13
191 0.11
192 0.11
193 0.12
194 0.1
195 0.11
196 0.11
197 0.12
198 0.11
199 0.11
200 0.1
201 0.11
202 0.11
203 0.1
204 0.09
205 0.08
206 0.08
207 0.07
208 0.07
209 0.05
210 0.06
211 0.06
212 0.07
213 0.07
214 0.08
215 0.09
216 0.1
217 0.17
218 0.24
219 0.24
220 0.25
221 0.26
222 0.24
223 0.24
224 0.23
225 0.18
226 0.13
227 0.15
228 0.15
229 0.16
230 0.17
231 0.17
232 0.17
233 0.17
234 0.14
235 0.12
236 0.14
237 0.13
238 0.12
239 0.12
240 0.13
241 0.11
242 0.12
243 0.12
244 0.09
245 0.1
246 0.1
247 0.1
248 0.09
249 0.09
250 0.09
251 0.09
252 0.09
253 0.07
254 0.07
255 0.07
256 0.07
257 0.07
258 0.06
259 0.05
260 0.05
261 0.06
262 0.06
263 0.06
264 0.07
265 0.12
266 0.14
267 0.15
268 0.19
269 0.19
270 0.21
271 0.23
272 0.23
273 0.2
274 0.18
275 0.21
276 0.16
277 0.18
278 0.2
279 0.18
280 0.16
281 0.15
282 0.14
283 0.11
284 0.12
285 0.11
286 0.06
287 0.08
288 0.08
289 0.08
290 0.08
291 0.08
292 0.08
293 0.09
294 0.09
295 0.07
296 0.07
297 0.07
298 0.08
299 0.1
300 0.09
301 0.08
302 0.08
303 0.08
304 0.08
305 0.08
306 0.07
307 0.05
308 0.04
309 0.04
310 0.04
311 0.04
312 0.04
313 0.04
314 0.04
315 0.05
316 0.05
317 0.05
318 0.05
319 0.05
320 0.05
321 0.07
322 0.08
323 0.1
324 0.14
325 0.16
326 0.24
327 0.34
328 0.42
329 0.51
330 0.61
331 0.65
332 0.73
333 0.82
334 0.84
335 0.86
336 0.89
337 0.88
338 0.84
339 0.81
340 0.79
341 0.78
342 0.71
343 0.61
344 0.53
345 0.46
346 0.4
347 0.38
348 0.29
349 0.2
350 0.15
351 0.15
352 0.15
353 0.13
354 0.15
355 0.13
356 0.16
357 0.25
358 0.24
359 0.25
360 0.28
361 0.32
362 0.4
363 0.45
364 0.47
365 0.39
366 0.43
367 0.42
368 0.38
369 0.34
370 0.25
371 0.2
372 0.16
373 0.16
374 0.11
375 0.13
376 0.17
377 0.21
378 0.21
379 0.21
380 0.23
381 0.24
382 0.3
383 0.29
384 0.3
385 0.26
386 0.26
387 0.25
388 0.23
389 0.23
390 0.18
391 0.17
392 0.15
393 0.15
394 0.16
395 0.16
396 0.16
397 0.14