Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74981

Protein Details
Accession O74981    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-43VFSKGKKLRCTCFPKRKKEASERSCFPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 12.166, nucl 6.5, cyto_nucl 6.333
Family & Domain DBs
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0051321  P:meiotic cell cycle  
KEGG spo:SPCC338.02  -  
Amino Acid Sequences MEVQKIWKSFLNAISKVFSKGKKLRCTCFPKRKKEASERSCFPFLDTETISSCDLSDDVLSPKLFAKNSYRCSLKETKCIDVIVSHNSLAPQFTEIRYTDGISAKAENTDEMTMHIALAPLTENQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.38
4 0.39
5 0.35
6 0.36
7 0.43
8 0.5
9 0.57
10 0.62
11 0.63
12 0.68
13 0.75
14 0.76
15 0.79
16 0.8
17 0.8
18 0.83
19 0.86
20 0.85
21 0.87
22 0.87
23 0.84
24 0.84
25 0.77
26 0.73
27 0.67
28 0.58
29 0.48
30 0.4
31 0.32
32 0.27
33 0.23
34 0.18
35 0.17
36 0.19
37 0.18
38 0.14
39 0.13
40 0.09
41 0.09
42 0.08
43 0.06
44 0.06
45 0.07
46 0.09
47 0.09
48 0.09
49 0.1
50 0.12
51 0.12
52 0.13
53 0.2
54 0.25
55 0.29
56 0.33
57 0.34
58 0.33
59 0.39
60 0.47
61 0.42
62 0.44
63 0.43
64 0.42
65 0.41
66 0.41
67 0.34
68 0.27
69 0.26
70 0.21
71 0.19
72 0.16
73 0.15
74 0.15
75 0.15
76 0.13
77 0.11
78 0.1
79 0.1
80 0.1
81 0.13
82 0.14
83 0.17
84 0.17
85 0.18
86 0.19
87 0.2
88 0.2
89 0.18
90 0.19
91 0.16
92 0.17
93 0.17
94 0.14
95 0.14
96 0.14
97 0.13
98 0.13
99 0.15
100 0.13
101 0.13
102 0.13
103 0.1
104 0.09
105 0.09