Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SNG2

Protein Details
Accession R7SNG2    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-72QRNDSTHGKRKKNTIRHPKSTAEHydrophilic
188-218PSQEASVRKRGRPRNHRRRPVPRIPPLFERPBasic
NLS Segment(s)
PositionSequence
195-211RKRGRPRNHRRRPVPRI
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG dsq:DICSQDRAFT_157242  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MGKKNKEQEPAAKLNSVTNRDIIQRINFLYQASTYLSTISQPPDGTVQLQRNDSTHGKRKKNTIRHPKSTAELSRCYVGSMRIVGQKAIVRMDPSLKRTLCKQCDTVLLPGATASVRVKPSGSHGQVVTYTCLSCSTSRRIPAPPVLDLDASTAEPFAPSTPVDRAPSSSAPGPLAEALSDIMDVYAPSQEASVRKRGRPRNHRRRPVPRIPPLFERPGHVVFRGNEVLPSQHINGSMVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.48
4 0.41
5 0.35
6 0.34
7 0.34
8 0.36
9 0.33
10 0.29
11 0.29
12 0.29
13 0.3
14 0.28
15 0.25
16 0.24
17 0.2
18 0.19
19 0.17
20 0.16
21 0.14
22 0.14
23 0.14
24 0.14
25 0.16
26 0.16
27 0.16
28 0.15
29 0.16
30 0.17
31 0.18
32 0.19
33 0.23
34 0.26
35 0.28
36 0.3
37 0.3
38 0.28
39 0.33
40 0.36
41 0.38
42 0.42
43 0.48
44 0.54
45 0.57
46 0.67
47 0.72
48 0.77
49 0.8
50 0.81
51 0.82
52 0.82
53 0.83
54 0.76
55 0.7
56 0.67
57 0.63
58 0.56
59 0.49
60 0.42
61 0.39
62 0.35
63 0.32
64 0.25
65 0.19
66 0.16
67 0.14
68 0.14
69 0.16
70 0.17
71 0.16
72 0.17
73 0.18
74 0.17
75 0.17
76 0.16
77 0.12
78 0.13
79 0.19
80 0.2
81 0.21
82 0.27
83 0.26
84 0.27
85 0.33
86 0.42
87 0.41
88 0.41
89 0.4
90 0.35
91 0.4
92 0.41
93 0.35
94 0.29
95 0.23
96 0.2
97 0.18
98 0.16
99 0.11
100 0.09
101 0.08
102 0.08
103 0.09
104 0.09
105 0.09
106 0.09
107 0.15
108 0.22
109 0.23
110 0.21
111 0.21
112 0.22
113 0.23
114 0.24
115 0.19
116 0.12
117 0.1
118 0.09
119 0.1
120 0.1
121 0.1
122 0.13
123 0.17
124 0.2
125 0.23
126 0.25
127 0.27
128 0.29
129 0.33
130 0.32
131 0.28
132 0.26
133 0.25
134 0.23
135 0.2
136 0.18
137 0.13
138 0.11
139 0.09
140 0.07
141 0.06
142 0.06
143 0.06
144 0.05
145 0.06
146 0.06
147 0.08
148 0.11
149 0.14
150 0.16
151 0.17
152 0.18
153 0.21
154 0.22
155 0.23
156 0.23
157 0.21
158 0.19
159 0.19
160 0.17
161 0.14
162 0.12
163 0.09
164 0.08
165 0.07
166 0.06
167 0.06
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.05
175 0.05
176 0.06
177 0.08
178 0.13
179 0.16
180 0.26
181 0.3
182 0.36
183 0.46
184 0.56
185 0.64
186 0.71
187 0.79
188 0.81
189 0.87
190 0.92
191 0.94
192 0.95
193 0.94
194 0.94
195 0.93
196 0.92
197 0.9
198 0.84
199 0.81
200 0.77
201 0.73
202 0.64
203 0.58
204 0.53
205 0.49
206 0.46
207 0.39
208 0.39
209 0.33
210 0.38
211 0.37
212 0.31
213 0.27
214 0.26
215 0.27
216 0.23
217 0.26
218 0.21
219 0.2
220 0.21