Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O13804

Protein Details
Accession O13804   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
99-120QKKAEPSAPPKGSKKKKRGKKKBasic
NLS Segment(s)
PositionSequence
101-120KAEPSAPPKGSKKKKRGKKK
Subcellular Location(s) nucl 17, cyto_nucl 13.333, mito_nucl 9.999, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0005829  C:cytosol  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MVYLQTVNEFFTQSKSLTEAYPKTTKLSIKYRTNEQSQNYLIAKAFESASGICLKYRTDKAAELGRLLLIANKLSYVSTGNEIPPEPEQEVVASPVTEQKKAEPSAPPKGSKKKKRGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.18
5 0.24
6 0.23
7 0.27
8 0.32
9 0.31
10 0.32
11 0.35
12 0.37
13 0.37
14 0.44
15 0.47
16 0.51
17 0.54
18 0.6
19 0.61
20 0.64
21 0.63
22 0.57
23 0.54
24 0.46
25 0.47
26 0.39
27 0.34
28 0.28
29 0.22
30 0.2
31 0.15
32 0.14
33 0.09
34 0.09
35 0.07
36 0.09
37 0.09
38 0.09
39 0.08
40 0.09
41 0.09
42 0.13
43 0.14
44 0.15
45 0.16
46 0.16
47 0.19
48 0.23
49 0.23
50 0.19
51 0.18
52 0.15
53 0.13
54 0.12
55 0.11
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.09
66 0.1
67 0.11
68 0.12
69 0.12
70 0.14
71 0.13
72 0.15
73 0.13
74 0.13
75 0.13
76 0.12
77 0.13
78 0.13
79 0.12
80 0.09
81 0.08
82 0.15
83 0.17
84 0.18
85 0.18
86 0.2
87 0.27
88 0.29
89 0.32
90 0.34
91 0.39
92 0.48
93 0.53
94 0.57
95 0.59
96 0.68
97 0.75
98 0.77
99 0.82
100 0.82