Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7T2U7

Protein Details
Accession R7T2U7    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
136-157AQRMSCAARRKTKRQEDRALLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 7.5, cyto_nucl 5.5, nucl 2.5, plas 2, extr 2, pero 2
Family & Domain DBs
KEGG dsq:DICSQDRAFT_59142  -  
Amino Acid Sequences KVRSFCSLAAEQGYGWAWLDTCCIDKASRAELSEAINSMYAWYKAADVCYVYLFDLDDGDHPFDKDSQFRASEWHSRAWTLQELLAPTDVVFLAKSWALIGRLAVLAPVLAEICGRDRTILRGYSAWKRKQQTSVAQRMSCAARRKTKRQEDRALLVMGIFGVSIPNVYGEGLERACLWLYVAGGDEPLRRSDYLRVGPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.11
4 0.09
5 0.09
6 0.11
7 0.09
8 0.11
9 0.11
10 0.13
11 0.13
12 0.16
13 0.19
14 0.23
15 0.25
16 0.24
17 0.25
18 0.25
19 0.27
20 0.25
21 0.22
22 0.17
23 0.15
24 0.13
25 0.13
26 0.13
27 0.1
28 0.09
29 0.09
30 0.1
31 0.1
32 0.12
33 0.11
34 0.1
35 0.11
36 0.11
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.07
43 0.06
44 0.07
45 0.09
46 0.1
47 0.11
48 0.11
49 0.11
50 0.13
51 0.14
52 0.14
53 0.15
54 0.17
55 0.18
56 0.18
57 0.2
58 0.23
59 0.29
60 0.29
61 0.31
62 0.28
63 0.27
64 0.28
65 0.27
66 0.25
67 0.18
68 0.17
69 0.14
70 0.13
71 0.13
72 0.13
73 0.1
74 0.08
75 0.08
76 0.07
77 0.05
78 0.05
79 0.04
80 0.05
81 0.05
82 0.05
83 0.04
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.04
93 0.03
94 0.03
95 0.03
96 0.02
97 0.02
98 0.03
99 0.03
100 0.05
101 0.06
102 0.06
103 0.07
104 0.08
105 0.11
106 0.15
107 0.16
108 0.16
109 0.17
110 0.21
111 0.29
112 0.37
113 0.4
114 0.43
115 0.46
116 0.49
117 0.54
118 0.57
119 0.58
120 0.59
121 0.63
122 0.62
123 0.58
124 0.54
125 0.51
126 0.48
127 0.44
128 0.42
129 0.39
130 0.42
131 0.5
132 0.6
133 0.67
134 0.75
135 0.8
136 0.81
137 0.85
138 0.82
139 0.79
140 0.73
141 0.63
142 0.52
143 0.41
144 0.31
145 0.21
146 0.13
147 0.08
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.05
156 0.05
157 0.06
158 0.09
159 0.09
160 0.1
161 0.1
162 0.11
163 0.11
164 0.11
165 0.1
166 0.08
167 0.09
168 0.09
169 0.1
170 0.09
171 0.09
172 0.11
173 0.13
174 0.13
175 0.15
176 0.18
177 0.17
178 0.2
179 0.25
180 0.32