Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9USH2

Protein Details
Accession Q9USH2    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
83-103EYNRARRKAKRHYLDKHLPVPBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 11, mito 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
IPR039251  OXLD1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016491  F:oxidoreductase activity  
KEGG spo:SPCP31B10.02  -  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences MHLTLFKELLKQPKPKFHFEIEPNVSFLAVEEGPASLRSYSIGNVSRIYDGIRVPPKPEEPLNCCQSGCAICVWDVYADDLEEYNRARRKAKRHYLDKHLPVPPDLAKVSLKETSSLEELPPQLKAFVLLEKRLMKDKQSKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.68
4 0.64
5 0.66
6 0.61
7 0.65
8 0.61
9 0.57
10 0.5
11 0.45
12 0.38
13 0.28
14 0.24
15 0.17
16 0.1
17 0.09
18 0.08
19 0.08
20 0.09
21 0.1
22 0.11
23 0.07
24 0.07
25 0.07
26 0.08
27 0.09
28 0.13
29 0.16
30 0.16
31 0.17
32 0.18
33 0.18
34 0.17
35 0.18
36 0.14
37 0.12
38 0.17
39 0.21
40 0.2
41 0.22
42 0.24
43 0.25
44 0.26
45 0.29
46 0.28
47 0.29
48 0.35
49 0.36
50 0.34
51 0.32
52 0.29
53 0.27
54 0.23
55 0.17
56 0.11
57 0.09
58 0.08
59 0.08
60 0.08
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.07
71 0.11
72 0.15
73 0.17
74 0.23
75 0.29
76 0.38
77 0.48
78 0.58
79 0.63
80 0.69
81 0.75
82 0.8
83 0.83
84 0.8
85 0.76
86 0.7
87 0.61
88 0.52
89 0.48
90 0.39
91 0.33
92 0.27
93 0.22
94 0.19
95 0.19
96 0.21
97 0.22
98 0.21
99 0.19
100 0.19
101 0.2
102 0.22
103 0.21
104 0.19
105 0.19
106 0.2
107 0.19
108 0.2
109 0.18
110 0.15
111 0.14
112 0.16
113 0.13
114 0.19
115 0.22
116 0.22
117 0.28
118 0.32
119 0.35
120 0.4
121 0.41
122 0.42
123 0.48