Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SQY8

Protein Details
Accession R7SQY8    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-77EEELNARRERKREKKEKERREREREKEKTEKKRVKABasic
183-210MESDGSMHKRPRKKRPAARKGWKGWVEGBasic
NLS Segment(s)
PositionSequence
48-80RRERKREKKEKERREREREKEKTEKKRVKAASK
190-205HKRPRKKRPAARKGWK
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
KEGG dsq:DICSQDRAFT_111848  -  
Amino Acid Sequences MSYPYKRRRTATSVLAGDFDPRPQRDVLTSLLNGVSMPKPTEEELNARRERKREKKEKERREREREKEKTEKKRVKAASKAPEAVAAPIPSTSGTPATSSAIAPLKSASIAAPRATTSSFWQARPQIVIPYLQRSASFSPPPMPSSPPTTPGPSVSSRTSAVSSKRPFTPDDDDELPGRQQSMESDGSMHKRPRKKRPAARKGWKGWVEGSPPPSDKLINLDSVTVLAERKTRSGKSFDAIGAGRDGWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.45
4 0.41
5 0.33
6 0.3
7 0.27
8 0.25
9 0.27
10 0.26
11 0.28
12 0.27
13 0.29
14 0.27
15 0.25
16 0.24
17 0.23
18 0.22
19 0.21
20 0.18
21 0.18
22 0.16
23 0.13
24 0.14
25 0.13
26 0.15
27 0.16
28 0.2
29 0.2
30 0.26
31 0.29
32 0.38
33 0.43
34 0.45
35 0.49
36 0.53
37 0.61
38 0.64
39 0.7
40 0.72
41 0.77
42 0.83
43 0.9
44 0.94
45 0.95
46 0.95
47 0.94
48 0.94
49 0.94
50 0.92
51 0.92
52 0.89
53 0.86
54 0.86
55 0.85
56 0.85
57 0.86
58 0.84
59 0.78
60 0.79
61 0.78
62 0.76
63 0.75
64 0.73
65 0.71
66 0.68
67 0.65
68 0.56
69 0.5
70 0.42
71 0.35
72 0.28
73 0.18
74 0.13
75 0.11
76 0.11
77 0.09
78 0.09
79 0.08
80 0.07
81 0.07
82 0.08
83 0.09
84 0.1
85 0.1
86 0.1
87 0.12
88 0.13
89 0.13
90 0.12
91 0.11
92 0.1
93 0.1
94 0.1
95 0.08
96 0.08
97 0.09
98 0.09
99 0.1
100 0.1
101 0.11
102 0.11
103 0.11
104 0.11
105 0.18
106 0.2
107 0.2
108 0.24
109 0.25
110 0.25
111 0.26
112 0.24
113 0.17
114 0.16
115 0.18
116 0.15
117 0.17
118 0.17
119 0.15
120 0.15
121 0.16
122 0.18
123 0.19
124 0.19
125 0.16
126 0.2
127 0.21
128 0.23
129 0.22
130 0.22
131 0.2
132 0.26
133 0.26
134 0.26
135 0.27
136 0.28
137 0.27
138 0.26
139 0.28
140 0.23
141 0.26
142 0.23
143 0.23
144 0.21
145 0.22
146 0.22
147 0.22
148 0.23
149 0.28
150 0.3
151 0.31
152 0.33
153 0.34
154 0.33
155 0.35
156 0.39
157 0.33
158 0.36
159 0.34
160 0.33
161 0.32
162 0.32
163 0.27
164 0.19
165 0.18
166 0.12
167 0.1
168 0.09
169 0.13
170 0.13
171 0.13
172 0.14
173 0.17
174 0.21
175 0.27
176 0.32
177 0.35
178 0.42
179 0.52
180 0.61
181 0.69
182 0.76
183 0.81
184 0.86
185 0.9
186 0.92
187 0.94
188 0.93
189 0.89
190 0.88
191 0.82
192 0.73
193 0.65
194 0.59
195 0.53
196 0.48
197 0.44
198 0.39
199 0.36
200 0.35
201 0.34
202 0.28
203 0.24
204 0.25
205 0.24
206 0.23
207 0.22
208 0.21
209 0.19
210 0.19
211 0.19
212 0.14
213 0.12
214 0.1
215 0.14
216 0.15
217 0.2
218 0.26
219 0.3
220 0.34
221 0.39
222 0.41
223 0.41
224 0.44
225 0.39
226 0.38
227 0.34
228 0.31
229 0.27