Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SJN5

Protein Details
Accession R7SJN5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-30LPESQGHRRKHRQVMRKHLAGBasic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 5, cyto 2, E.R. 2
Family & Domain DBs
KEGG dsq:DICSQDRAFT_71566  -  
Amino Acid Sequences MVPSILARLLPESQGHRRKHRQVMRKHLAGSGVRTRVEKVMALLVESGVVYVLIWVRWWYCAHHSLLLNPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.51
4 0.59
5 0.67
6 0.74
7 0.77
8 0.77
9 0.78
10 0.84
11 0.82
12 0.77
13 0.69
14 0.6
15 0.55
16 0.47
17 0.42
18 0.36
19 0.3
20 0.26
21 0.26
22 0.25
23 0.22
24 0.21
25 0.16
26 0.11
27 0.12
28 0.11
29 0.11
30 0.1
31 0.08
32 0.08
33 0.07
34 0.06
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.09
45 0.1
46 0.13
47 0.18
48 0.23
49 0.25
50 0.31
51 0.32